QueenslandFoodProduction(Safety)Act2000FoodProduction(Safety)Regulation2002Current as at 1 January 2014Reprint noteThis is the last
reprint before repeal. Repealed on 1 September 2014 by2014
SL No. 197 s 207.
Information about this reprintThis
reprint shows the legislation current as at the date on the cover
and is authorised bythe Parliamentary Counsel.AnewreprintofthelegislationwillbepreparedbytheOfficeoftheQueenslandParliamentary
Counsel when any change to the legislation takes effect. This
change maybe because a provision of the original
legislation, or an amendment to it, commences orbecause a particular provision of the
legislation expires or is repealed.When a new reprint
is prepared, this reprint will become a historical reprint. Also,
if it isnecessary to replace this reprint before a
new reprint is prepared, for example, to includeamendments with a retrospective commencement,
an appropriate note would be includedonthecoverofthereplacementreprintandonthecopyofthisreprintatwww.legislation.qld.gov.au.The
endnotes to this reprint contain detailed information about the
legislation and reprint.For example—•The
table of reprints endnote lists any previous reprints and, for this reprint, givesdetails of any discretionary editorial powers under theReprints Act 1992used by theOffice of the Queensland Parliamentary Counsel in preparing it.•Thelistoflegislationendnotegiveshistoricalinformationabouttheoriginallegislationandthelegislationwhichamendedit.Italsogivesdetailsofuncommencedamendmentstothislegislation.Forinformationaboutpossibleamendments to the
legislation by Bills introduced in Parliament, see the
QueenslandLegislationCurrentAnnotationsatwww.legislation.qld.gov.au/Leg_Info/information.htm.•The
list of annotations endnote gives historical information at section
level.All Queensland reprints are dated and
authorised by the Parliamentary Counsel. Theprevious numbering
system and distinctions between printed and electronic reprints
arenot continued.
Food
Production (Safety) Regulation 2002Chapter 1
Preliminary[s 1]Food Production
(Safety) Regulation 2002[as amended by all amendments that
commenced on or before 1 January 2014]Chapter 1Preliminary1Short
titleThis regulation may be cited as theFood
Production (Safety)Regulation 2002.2CommencementThis regulation
commences on 1 January 2003.3DictionaryThe dictionary
in schedule 6 defines particular words used inthis
regulation.Chapter 2Food safety
schemesPart 1Standards for
food safetyschemes4Compulsory standard and advisory
standard(1)Acompulsory
standardmentioned in—Current as at 1
January 2014Page 11
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 1 Standards for food safety
schemes[s 5](a)for
the dairy scheme—schedule 2, part 1, column 2 isthe
standard for a requirement mentioned in column 1 ofthe
schedule opposite the requirement; or(b)for
the egg scheme—schedule 3A, part 1, column 2 isthe standard for
a requirement mentioned in column 1 ofthe schedule
opposite the requirement; or(c)for
the meat scheme—schedule 4, part 1, column 2 isthe standard for
a requirement mentioned in column 1 ofthe schedule
opposite the requirement.(2)Anadvisory standardmentioned
in—(a)for the dairy scheme—schedule 2, part
2, column 2 isthe standard for a requirement mentioned in
column 1 ofthe schedule opposite the requirement;
or(b)for the egg scheme—schedule 3A, part
2, column 2 isthe standard for a requirement mentioned in
column 1 ofthe schedule opposite the requirement;
or(c)for the meat scheme—schedule 4, part
2, column 2 isthe standard for a requirement mentioned in
column 1 ofthe schedule opposite the
requirement.5Complying with compulsory
standardIf a compulsory standard states—(a)a requirement for a provision of a
food safety scheme, aprogramormanagementstatementcomplieswiththescheme for the requirement only by
complying with therequirement in the standard; or(b)a way of preventing or managing
exposure to a risk for arequirementinafoodsafetyscheme,aprogramormanagementstatementcomplieswiththeschemeforthe
requirement only by adopting and following a statedway
in the standard.Page 12Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 1A Accreditations register[s
6]6Complying with advisory
standardIfanadvisorystandardstatesawayofpreventingormanaging exposure to a risk for a
requirement in a food safetyscheme, a
program or management statement complies withtheschemefortherequirementonlybyadoptingandfollowing—(a)a
stated way in the standard for the requirement; or(b)another way for the requirement that
gives the same or ahigher level of protection against the
risk.7Inconsistency between regulation and
standardsTo the extent a compulsory standard or
advisory standard isinconsistent with this regulation, the
regulation prevails.Part 1AAccreditations
register7ARegister of accreditations(1)Safe Food must keep a register of
accreditation holders (theaccreditations register).(2)Theaccreditationsregistermustcontain,foreachaccreditation
holder—(a)the holder’s accreditation number;
and(b)iftheholderisaneggproducer—theholder’seggproduction identification; and(c)the contact details for the holder’s
business, including itsbusiness name, address and telephone
number; and(d)the name and business address of the
proprietor of theholder’s business; and(e)details about the nature of the holder’s
business; andCurrent as at 1 January 2014Page
13
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 1A Accreditations register[s
7B](f)the location of all premises approved
for use under theholder’saccreditationfortheproductionofprimaryproduce.(3)TheaccreditationsregistermaycontainotherinformationaboutanaccreditationholderthatSafeFoodconsidersnecessary or desirable for the effective
administration of theAct.(4)Theaccreditationsregistermayalsocontaininformationaboutaformeraccreditationholder,includingwhethertheformeraccreditationholder’saccreditationwascancelledornot
renewed.(5)However,theinformationforaformeraccreditationholdermustberemovedfromtheaccreditationsregisterwithin1yearafterthedaytheformeraccreditationholder’saccreditation was cancelled or not
renewed.(6)In this section—formeraccreditationholdermeansapersonwhowasanaccreditationholderunderafoodsafetyschemebutisnolongeraccreditedundertheschemebecausetheperson’saccreditation
was cancelled or not renewed.7BChange to information in accreditations
register(1)Thissectionappliestoanaccreditationholderifachangehappensintheholder’sbusinessthatislikelytoresultininformation in the accreditations register
being incomplete orinaccurate.(2)The
accreditation holder must, within 14 days after the changeintheholder’sbusinesshappens,giveSafeFoodwrittennoticeofthechangeunlesstheholderhasareasonableexcuse.Maximum penalty—20 penalty units.Page
14Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 7C]7CAccreditations register to be available for
publicinspection(1)Safe
Food must keep the accreditations register, or a copy oftheaccreditationsregister,availableforinspection,freeofcharge, by members of the public at
Safe Food’s head office.Editor’s note—Safe
Food’s head office is at 12 Helen Street, Newstead,
Brisbane.(2)Safe Food may publish a copy of the
accreditations register onSafe Food’s website.Editor’s note—Safe
Food’s website is <www.safefood.qld.gov.au>.7DCertificate about contents of
accreditations registerAcertificatepurportingtobesignedbySafeFood’schiefexecutiveofficeraboutthecontentsoftheaccreditationsregister is
evidence of the matters stated in the certificate.Part
2Food safety programs andmanagement
statementsDivision 1Preliminary8Definitions for pt 2In this
part—controlmeasure,meansanyactionoractivitythatcanbeused—(a)to prevent or eliminate a food safety
hazard; or(b)to reduce a food safety hazard to an
acceptable level ofrisk.Current as at 1
January 2014Page 15
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 9]criticalcontrolpoint,forprocessingofprimaryproduce,meansastepduringtheprocessingthatisstatedinanaccreditation holder’s program and at
which it is essential toapply a control measure.operationalperformanceincludescheckingeachcriticalcontrol point is
appropriate for a control measure.Division 2Preparation and maintenance ofprograms and managementstatements9Preparation of programs and management
statements(1)This section applies to an applicant
for a grant or renewal ofan accreditation under a food safety
scheme.(2)Theapplicantmustprepareafoodsafetyprogram(aprogram) or a
management statement, as required under thescheme,foreachaspectoftheactivitiescarriedout,orproposed to be carried out, by the applicant
in connection withthe production of primary produce for
which—(a)the scheme applies; and(b)the applicant is applying for
accreditation.Note—In relation to
whether a program or management statement is requiredunder
a food safety scheme—•for the dairy
scheme—see section 57B•for the egg
scheme—see section 87CB•for the meat
scheme—see section 89B•for the seafood
scheme—see section 134F.(3)Withoutlimitingsubsection(2),aprogrammuststate,inaddition to the requirements in section
41(2) of the Act, howthe applicant will comply with each
food safety requirementapplying to the applicant’s activities
for the scheme.Page 16Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 9A]Note—For an applicant engaging in the
production of bivalve molluscs underthe seafood
scheme, see section 134V.9AManagement
statements(1)Thissectionappliestoapersonwhomustprepareandmaintainamanagementstatementunderafoodsafetyscheme.(2)The
management statement must—(a)identify
significant food safety hazards associated withtheproductionofprimaryproducecarriedoutbytheperson;
and(b)statehowthehazardsaretobemonitoredandcontrolled; and(c)state how the person will comply with each
food safetyrequirement applying to the person’s
activities under thescheme.(3)The
person must keep a copy of the management statement ateach
place to which the statement relates.Maximum
penalty—20 penalty units.9BApproving
management statements(1)This section
applies to an applicant for a grant or renewal ofan
accreditation if the applicant must prepare and maintain amanagementstatementfortheaccreditationunderafoodsafety
scheme.(2)SafeFoodmaygrantorrenewtheaccreditationonlyifsatisfied the applicant’s management
statement complies withsection 9A(2).(3)IfSafeFoodgrantstheaccreditation,theapplicant’smanagementstatementbecomestheapprovedmanagementstatement for
the accreditation.Current as at 1 January 2014Page
17
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 10]10Maintenance of programs and management
statements(1)An accreditation holder is the person
who must maintain theholder’sapprovedprogramorapprovedmanagementstatement under
a food safety scheme.(2)Theholdermustcomplywiththeprogramormanagementstatement.Maximum penalty
for subsection (2)—50 penalty units.Division 3Other information contained inprograms11Application of div 3Thisdivisionprescribes,undersection41(2)(f)oftheAct,otherinformationtobecontainedinanapplicant’soraccreditation holder’s program.12Risk assessment(1)Thissectionappliesforsignificantfoodsafetyhazardsassociated with the production of primary
produce identifiedin the program.(2)The
program must, for each hazard—(a)give
details of an assessment of the risks associated withthe
hazard (arisk assessment); and(b)identify each critical control
point.(3)Forsubsection(2)(a),theprogrammust,fortheriskassessment, state—(a)each
method considered to control the risks associatedwith
the hazard to achieve an acceptable level of risk;and(b)the control
measures.Page 18Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 13]13Systems for verifying compliance with
program(1)The program must contain systems
to—(a)monitorandevaluatetheholder’soperationalperformance;
and(b)verify the performance complies with
the program.(2)Forsubsection(1),thesystemsincludethemethods,procedures,
tests, monitoring and other evaluations the holderwilluseforcheckingtheholder’sperformanceagainsttheprogram.(3)Each
system must—(a)be adequately documented in the
program; and(b)function as documented; and(c)be appropriate for its objectives;
and(d)provideforcontrolstominimisetherisksassociatedwith the
holder’s operations.14Corrective actionThe program must
state—(a)detailsofcorrectiveactiontakenbytheholderiftheholder’sperformancedoesnotcomplywiththeprogram; and(b)thestepstakenbytheholdertoassesswhetherthecorrective action has been
effective.15Validation of control measures(1)This section applies for—(a)the treatment of primary produce to
destroy, reduce orcontrol food safety hazards; and(b)otherprocessingofprimaryproduceiftimeandtemperature controls are part of the
processing.Current as at 1 January 2014Page
19
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 16]Example for
paragraph (b) of other processing—1heat treatment2canning(2)Theprogrammustprovidevalidationofacontrolmeasureat—(a)each critical
control point; and(b)any other appropriate interval or
stage of a treatment orother process.Example—For heating or a cooking process, the
program must show the controlmeasures
implemented can ensure pathogens in primary produce are at alevel
that do not make the product unacceptable.(3)However, the program is not required to
provide validation ofa control measure if—(a)thecontrolmeasureiscontainedinacompulsorystandard;
or(b)the holder’s program is adopting or
following a statedway in an advisory standard for the control
measure.Division 4Record
keeping16Record keeping requirements(1)Anaccreditationholderunderafoodsafetyschememust,unless the holder has a reasonable excuse,
keep records for theholder’sbusinessthatcomplywithsubsections(2)to(6)and—(a)for the dairy scheme—sections 60 to 62
and 68; or(b)for the egg scheme—sections 87N and
87O; or(c)for the meat scheme—sections 94, 128,
129 and 131; or(d)for the seafood scheme—section
134T.Maximum penalty—20 penalty units.Page
20Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 16](2)The
records must demonstrate the holder has complied withtheschemeandtheholder’sprogramormanagementstatement.(3)The
records include—(a)a record made by the holder for the
business; and(b)a record in the holder’s
possession.Example for paragraph (b)—a document recording the results of a
pest inspection(4)The records must be kept in a way
that—(a)correctly records and explains the
holder’s activities andtransactions; and(b)enablesitsrecordstobeproperlyandconvenientlyaudited under
part 5.(5)There must be enough records to allow
Safe Food to—(a)monitortheholder’scompliancewiththeschemeandthe
holder’s program or management statement; and(b)tracefromthemthestagesthatapplytotheholder’sprogram or
management statement.Examples for paragraph (b) of stages
in a program or managementstatement—1supplying an animal to a dairy for
milking2supplying milk to a factory for
processing3supplying processed dairy produce to a
wholesaler4supplying an animal for killing5supplying meat or ready-to-eat meat
for processing(6)The records for primary produce must
be kept for the greaterof the following—(a)the
end of the use-by date on the produce;(b)the
completion of the compliance audit after the produceis
processed;(c)6 months after the record is
made.Current as at 1 January 2014Page
21
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 17]Division 5Amendment of programs andmanagement statementsSubdivision
1Amendment by Safe Food17Power
to amendSafe Food may, by complying with this
subdivision, amend anaccreditationholder’sapprovedprogramorapprovedmanagementstatementifitbelievestheamendmentisreasonablynecessaryordesirabletoensuretheprogramormanagement statement complies with the
relevant food safetyscheme.Editor’s
note—See section 51 (Amendment—grounds) of
the Act.18Notice of proposed amendment(1)Safe Food must give the holder a
written notice requiring theholder to amend
the holder’s approved program or approvedmanagement
statement.(2)The notice must state the
following—(a)the proposed amendment;(b)the grounds for the proposed
amendment;(c)thefactsandcircumstancesformingthebasisforthegrounds;(d)the
period within which the amendment must be made(theamendment period);(e)that representations may be made about
the notice;(f)how the representations may be
made;(g)where the representations may be made
or sent;Page 22Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 19](h)aperiod(theshowcauseperiod)formakingtherepresentationsoraperiodwithinwhichtherepresentations must be made.(3)The show cause period for making
representations must end atleast 14 days
after the notice is given.(4)Theamendmentperiodmustendatleast28daysafterthenotice is given.19Decision on proposed amendment(1)Iftheholdermakesrepresentationswithintheshowcauseperiod, Safe Food must—(a)consider the representations; and(b)decide if the proposed amendment
should be made; and(c)notify the holder of its decisions and
the reasons for itsdecision.(2)If
Safe Food decides the amendment must be made, the noticemust
state the period withinwhich the amendment must bemade.(3)The
stated period must end at least 14 days after the notice isgiven.20Holder’s obligation to make decided
amendment(1)The holder must comply with—(a)if the holder does not make any
representations to SafeFoodwithintheshowcauseperiod—thenoticegivenunder section
18; or(b)iftheholdermakesrepresentationstoSafeFoodandSafe Food notifies the holder that the
amendment mustbe made—the notice given under section
19(1)(c).Maximum penalty—20 penalty units.Current as at 1 January 2014Page
23
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 2 Food safety programs and management
statements[s 21](2)The
holder’s program or management statement, as amended,becomestheapprovedprogramorapprovedmanagementstatement for
the accreditation.Subdivision 2Amendment by
holder21When holder may amend(1)Anaccreditationholdermayamendtheholder’sapprovedprogram or approved management statement
without notice toSafeFoodiftheamendmentdoesnotamendanyofthefollowing
(asignificant food safety matter)—(a)a critical
control point in the program; or(b)a
control measure in the management statement; or(c)howoftentheprogramormanagementstatementisreviewed by the holder.(2)Anaccreditationholdermayamendtheholder’sapprovedprogramorapprovedmanagementstatementtoamendasignificant food safety matter only if Safe
Food has approvedthe amendment.(3)A
purported amendment made in contravention of subsection(2)
is of no effect.Editor’s note—Seealsosection10(2)(Maintenanceofprogramsandmanagementstatements).22Applying for approval(1)A
holder may apply in writing to Safe Food for approval toamend a significant food safety
matter.(2)The application must state the
following—(a)the proposed amendment;(b)the reason for the amendment;Page
24Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 3 Accreditation, fees and
auditors[s 23](c)theproposeddatebywhichtheamendmentistobemade.23Deciding application(1)If Safe Food approves the
amendment—(a)SafeFoodmustgivetheholderwrittennoticeoftheapprovalwithin28daysafterSafeFoodreceivestheapplication; and(b)theholder’sprogramormanagementstatement,asamended, becomes the approved program or
approvedmanagement statement for the
accreditation.(2)IfSafeFooddoesnotapprovetheamendment,SafeFoodmust, within 28
days after Safe Food receives the application,givetheholderwrittennoticestatingthedecisionandthereasons for it.Part 3Accreditation, fees andauditors24Accreditation—Act, s 40(1)(b)Forsection40(1)(b)oftheAct,apersonwhohasthemanagementandcontrolofabusinessthatengagesintheproduction of primary produce under a
food safety scheme isthepersonwhomustbeaccreditedundertheschemeandcomply with the scheme.25Accreditation period—Act, s 50(4)(1)Forsection50(4)oftheAct,theprescribedperiodforaccreditation is 1 year.Current as at 1 January 2014Page
25
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 3 Accreditation, fees and auditors[s
26](2)However, Safe Food may grant or renew
an accreditation forless than 1 year.26Fees
for accreditation and approval as auditor(1)The
fees payable under the Act are stated in schedule 1.(2)An application fee paid is not
refundable.27Fees for accreditation(1)For section 44(2)(b)(i) of the Act,
the prescribed fee is—(a)foragrantofanaccreditation,thetotalofthefollowing—(i)the
application fee under schedule 1, part 1;(ii)therelevantaccreditationfeeunderschedule1,part 1; or(b)forarenewalofanaccreditation,therelevantaccreditation
fee under schedule 1, part 1.(2)However,ifSafeFoodimposesaconditionontheaccreditationthattheholderpaystherelevantaccreditationfee under
schedule 1, part 1 in instalments,SafeFoodmaywaive the accreditation fee mentioned in
subsection (1)(a)(ii)or (b).27AExemptions from fees for
accreditation(1)Despitesections26and27,nofeeispayableforanapplicationforanaccreditation,orarenewalofanaccreditation, by—(a)a
school that must prepare and maintain a food safetyprogram under a food safety scheme;
or(b)aneggproducerwhosupplieseggsunderapreferredsupplier
arrangement; orPage 26Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 3 Accreditation, fees and
auditors[s 28](c)apoultryproducerwhosuppliespoultryunderapreferred supplier arrangement.(2)In this section—schoolmeans a school that is a State school or a
non-StateschoolwithinthemeaningoftheEducation(GeneralProvisions) Act 2006.28Fees for approval as auditorFor
section 60(2)(b) of the Act, the prescribed fee is—(a)foranapprovalasanauditor,thetotalofthefollowing—(i)the
application fee under schedule 1, part 2;(ii)the
auditor approval fee under schedule 1, part 2;or(b)for a renewal of an approval as an
auditor, the auditorapproval fee under schedule 1, part
2.28AWaiver of prescribed fee for approval
as auditorSafeFoodmaywaivetheprescribedfeepayableforanapproval, or renewal of approval, as
an auditor if the applicantis employed by
Safe Food as an auditor.29Payment of
renewal fee(1)Therenewalfeeforanapprovalasanauditorispayableyearly in
advance.(2)TherenewalfeeforanaccreditationispayableyearlyinadvanceunlessSafeFoodimposesaconditionontheaccreditation under section
27(2).(3)If an applicant for a renewal of an
accreditation does not paythe renewal fee, the applicant’s
current accreditation ends atthe end of the
period for which Safe Food previously grantedor renewed the
accreditation.Current as at 1 January 2014Page
27
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
30]30Deciding application for approval as
auditorIn deciding whether an applicant for an
approval as an auditorhasthenecessaryexpertiseorexperiencetocarryoutthefunctions of an auditor, Safe Food
must consider each of thefollowing things—(a)whetherornottheapplicanthasqualificationsinauditing food safety matters related to the
production ofprimary produce;(b)the
applicant’s expertise or experience in the activitiesconnectedwiththeaspectsofproductionofprimaryproduce under a
food safety scheme;(c)ifadepartmentorrecognisedaccreditationbodyhasapproved the applicant as an auditor
in the field of foodsafety—the approval.Part
4Food safety requirementsDivision 1Preliminary31Application of pt 4(1)Thispartappliesforfoodsafetyrequirementsforafoodsafety scheme,
other than the seafood scheme.(2)Other food safety requirements for each food
safety schemeare mentioned in—(a)forthedairyscheme—chapter3,part2andpart3,division 3; or(b)for
the egg scheme—chapter 3A, part 2; or(c)for
the meat scheme—chapter 4, part 2.Page 28Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
31A]31AComplying with compulsory or advisory
standard(1)Ifacompulsorystandardmentionedinthefollowingprovisions
states a requirement for a provision under this part,aprogramormanagementstatementunderafoodsafetyschememustcomplywiththecompulsorystandardfortherequirement—(a)for
the dairy scheme—schedule 2, part 1;(b)for
the egg scheme—schedule 3A, part 1;(c)for
the meat scheme—schedule 4, part 1.(2)If
an advisory standard mentioned in the following provisionsstates a requirement for a provision under
this part, a programormanagementstatementunderafoodsafetyschememustcomply with the advisory standard for the
requirement—(a)for the dairy scheme—schedule 2, part
2;(b)for the egg scheme—schedule 3A, part
2;(c)for the meat scheme—schedule 4, part
2.Note—See section 5
(Complying with compulsory standard) or 6 (Complyingwith
advisory standard) for how a program or management statementunder
a food safety scheme complies with a compulsory or advisorystandard.Division 2General food safety requirements32Skills and knowledge for persons
processing primaryproduce(1)An
accreditation holder who processes primary produce mustensureallpersonsinvolvedintheprocessinghavetheappropriateskillsandknowledgetoensuretheproduceisacceptable.Maximum
penalty—20 penalty units.(2)The holder
complies with subsection (1) only if the holder—Current as at 1 January 2014Page
29
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
33](a)makesandimplementsguidelinesfortrainingintheholder’s program or management
statement; and(b)takes reasonable steps to ensure the
persons involved inthe processing comply with the
guidelines.33Transporting primary produce(1)Anaccreditationholderwhousesavehicletotransportprimary produce
must comply with subsections (2) to (4) forthe
transportation of the produce.Maximum
penalty—20 penalty units.(2)Theproducemustbemaintainedunderconditionsthatensures the produce is acceptable.(3)Without limiting subsection (2), the
conditions under whichthe produce is transported must
include time and temperaturecontrols to
prevent, reduce or control pathogenic growth.(4)Thepartofthevehiclecontainingtheproducemustbedesigned and constructed from
materials that—(a)prevent contamination of the produce;
and(b)are capable of being easily and
effectively cleaned; and(c)prevent foreign
substances, including pests and vermin,entering the
vehicle.(5)Also, the holder must ensure the part
of the vehicle containingthe produce is maintained and cleaned
in a sanitary way.Maximum penalty—20 penalty units.(5A)Without limiting
subsection (1), if the accreditation holder istransporting
dairy produce, the holder must ensure the dairyproduceistransportedinawaythatcomplieswiththecompulsory standard for the
transportation.Maximum penalty—20 penalty units.(6)If a person transporting primary
produce for an accreditationholder becomes
aware or reasonably believes the produce hasbeenexposedtoconditionsthatmayhaveaffectedthePage 30Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
34]acceptabilityoftheproduce,thepersonmustimmediatelynotify the
holder, unless the person has a reasonable excuse.Maximum penalty—20 penalty units.34Water supplyAn accreditation
holder who uses a water supply to processprimary produce
may use the water supply only if—(a)the
water is of potable quality; or(b)theholderdemonstratesintheholder’sprogramormanagement statement that the use of
the water will notmake the produce unacceptable.Maximum penalty—20 penalty units.35Waste disposal at premises(1)Anaccreditationholderwhoprocessesprimaryproduceatpremises must store, handle, or dispose of
waste in a way thatwill not make the produce
unacceptable.Maximum penalty—20 penalty units.(2)Without limiting subsection
(1)—(a)solid and liquid waste produced by the
processing of theproducemustbecontainedandremovedtoawastedisposal system;
and(b)the ventilation system must be
adequate to remove fromthe premises fumes and other gaseous
waste producedby the processing.36Restrictions on animals at premises and in
vehicles(1)Anaccreditationholderwhoprocessesprimaryproduceatpremises or uses a vehicle for the
processing may allow ananimal on the premises or in the
vehicle only ifthe animalis—Current as at 1 January 2014Page
31
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
37](a)ananimaltobeslaughteredatthepremisesorinthevehicle;
or(b)an assistance animal; or(c)a work animal.Maximum
penalty—20 penalty units.(2)However, the
holder must not allow an assistance animal orwork animal on
the part of the premises or in the part of thevehicle where
the processing is carried out.Maximum
penalty—20 penalty units.(3)In this
section—work animalmeans—(a)ananimal,including,forexample,aleaderanimal,horse or dog, used, or to be used—(i)to help in moving or handling animals
to be killedfor meat; or(ii)forananimalkilledinthewild—tofindtheanimal; or(b)a
dog used, or to be used, for security.Division 3Health and hygiene of persons, andpremises, vehicles and equipment37Application of div 3This
division does not apply to an accreditation holder whoproduces milk from an animal at a
dairy.Editor’s note—Seesections65(Healthandhygienerequirements),66(Design,construction and
maintenance of dairy and equipment) and 78 (Design,construction and maintenance of dairy and
equipment).Page 32Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
38]38Health and hygiene requirements(1)Anaccreditationholderprocessingprimaryproduceatpremisesmustensureallpersonsprocessingtheproduceatthepremisesmaintainahighlevelofhealthandhygienepractices to
prevent contamination of the produce.Maximum
penalty—20 penalty units.(2)Measures a
holder must take under subsection (1) include—(a)providing adequate health and hygiene
facilities at thepremisesandensuringtheirappropriateusebythepersons
processing the produce; and(b)establishing and maintaining appropriate
procedures andpractices for health and hygiene.39Design, construction and maintenance
of premises andvehicles(1)This
section applies to an accreditation holder who—(a)processes primary produce at premises;
or(b)uses a vehicle for processing primary
produce.(2)The holder must ensure the premises or
vehicle is designedandconstructedsothatthepremisesorpartofthevehiclecontaining the
produce—(a)provides enough space for the
activities and equipmentused for the processing; and(b)provides adequate natural or
artificial lighting for eachof the
processing activities carried on at the premises orin
the vehicle; and(c)provides adequate ventilation to
remove heat and steamand to control condensation and
humidity; and(d)allows for a person handling the
produce to maintain ahigh level of health and hygiene
practices; and(e)is capable of being effectively
cleaned and sanitised; andCurrent as at 1 January 2014Page
33
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 4 Food safety requirements[s
40](f)excludesdust,dirt,fumes,smoke(otherthansmokefrom
a smoking process) and other contaminants; and(g)prevents the entry and harbouring of
pests.Maximum penalty—20 penalty units.(3)Also,theholdermustensurethepremisesorpartofthevehicle containing the produce is
maintained and cleaned in asanitary
way.Maximum penalty—20 penalty units.40Design, construction and maintenance
of equipment(1)An accreditation holder who processes
primary produce mustensure the equipment used for the
processing is designed andconstructed so that the equipment
is—(a)suitable for the equipment’s intended
use; and(b)capable of being effectively cleaned
and sanitised; and(c)made of material that does not
contaminate food.Maximum penalty—20 penalty units.(2)Also, the holder must ensure the
equipment is maintained andcleaned in a
sanitary way.Maximum penalty—20 penalty units.Page
34Current as at 1 January 2014
Part
5Food Production (Safety) Regulation
2002Chapter 2 Food safety schemesPart
5 Monitoring compliance with food safety schemes[s
40A]Monitoring compliance withfood
safety schemesDivision 1AAMonitoring40AGeneral requirements for monitoring
compliance(1)Safe Food may monitor compliance with
food safety schemesby 1 or more methods that are considered
appropriate to thenature of the business engaging in the
production of primaryproduce and the risks associated with
the business.(2)However, Safe Food must conduct the
audits required underthis part.Note—See, however, section 50A (Safe Food
may vary frequency of audits).40BCheck
audits and monitoring(1)Safe Food may
conduct a check audit of a program audited byanauditortoensuretheauditorisconductingauditstothesatisfaction of
Safe Food.(2)Safe Food may recover from the holder
Safe Food’s costs forconducting the check audit.(3)Safe Food may also conduct a check
audit of a program, ormonitoring of a management statement,
under a food safetyscheme to verify the effectiveness of the
scheme.Example of a check audit of a program—a check audit may include a spot
check(4)In this section—checkaudit,ofaprogram,meansanauditoftheprogram,otherthanacomplianceauditornonconformanceaudit,conducted by Safe Food.Current as at 1
January 2014Page 35
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 42]Division 1General auditing requirement42Cooperating with auditorA
person who is audited must assist in the audit and cooperatewiththeauditorconductingtheauditunderafoodsafetyscheme.Maximum
penalty—20 penalty units.Division 2Risk categories
and minor, majorand critical nonconformances43Frequency of audits for risk
category(1)Theriskcategoryfortheprocessingofprimaryproduceisdecided by the potential public health
risk associated with theprocessing.(2)Theriskcategoryapplyingtotheactivitiescarriedout,orproposed to be carried out, by a person for
the processing ofprimaryproducedecidesthefrequencyofauditsundertheAct.(3)The
activities classified aslow riskare
mentioned—(a)for the dairy scheme—in schedule 3,
part 1; or(b)for the egg scheme—in schedule 3B,
part 1; or(c)for the meat scheme—in schedule 5,
part 1; or(d)for the seafood scheme—in schedule 5A,
part 1.(4)The activities classified asmedium riskare
mentioned—(a)for the meat scheme—in schedule 5,
part 2; or(b)for the seafood scheme—in schedule 5A,
part 2.(5)The activities classified ashigh
riskare mentioned—(a)for
the dairy scheme—in schedule 3, part 2; orPage 36Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 44](b)for
the egg scheme—in schedule 3B, part 2; or(c)for
the meat scheme—in schedule 5, part 3; or(d)for
the seafood scheme—in schedule 5A, part 3.44Minor, major and critical
nonconformances(1)Aminor
nonconformancemeans a nonconformance with therequirementsofanaccreditationholder’sprogramifthepotential impact of the nonconformance
is not likely to lead tothe production of unacceptable primary
produce.(2)Amajor
nonconformancemeans a nonconformance with therequirementsofanaccreditationholder’sprogramifthepotentialimpactofthenonconformancemayleadtotheproduction of unacceptable primary
produce unless remedialaction is taken by the holder to
correct the nonconformance.(3)Acriticalnonconformancemeansanonconformancewiththe
requirements of an accreditation holder’s program if thepotentialimpactofthenonconformanceisofsubstantialorimmediatesignificanceandislikelytoresultin,orhasresulted in, the
production of unacceptable primary produce.Division 3Audits for grants and renewals ofaccreditation45Audits for grant of accreditation—low
risk(1)This section applies to an applicant
for a grant of accreditationiftheactivitiesproposedtobecarriedoutbytheapplicantunder a food
safety scheme are low risk.(2)Safe
Food must audit the applicant’s program and may grantanaccreditationonlyifSafeFoodissatisfiedtheprogramcomplies with
the scheme.(3)Iftheapplicantisgrantedaccreditation,SafeFoodmustconduct a compliance audit of the
program—Current as at 1 January 2014Page
37
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 46](a)within 6 months after accreditation;
and(b)within 1 year after the first
compliance audit.(4)However,ifacriticalnonconformanceisidentifiedatacomplianceaudit,SafeFoodmustconductanadditionalcomplianceauditoftheprogramwithin6monthsafterthecompliance audit.(5)Subsections (3) and (4) do not apply if Safe
Food approves analternative verification system in the
applicant’s program.Example of verification system—1monitoring test
results2self verification3regular inspections46Audits for grant of accreditation—medium
risk(1)This section applies to an applicant
for a grant of accreditationiftheactivitiesproposedtobecarriedoutbytheapplicantunder a food
safety scheme are medium risk.(2)Safe
Food must audit the applicant’s program and may grantanaccreditationonlyifSafeFoodissatisfiedtheprogramcomplies with
the scheme.(3)Iftheapplicantisgrantedaccreditation,SafeFoodmustconduct a compliance audit of the
program—(a)within 3 months after accreditation;
and(b)within 6 months after the first
compliance audit; and(c)within 1 year
after the previous compliance audit.(4)However,ifacriticalnonconformanceisidentifiedatacomplianceaudit,SafeFoodmustconductanadditionalcomplianceauditoftheprogramwithin6monthsafterthecompliance audit.Page 38Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 47]47Audits for grant of accreditation—high
risk(1)This section applies to an applicant
for a grant of accreditationiftheactivitiesproposedtobecarriedoutbytheapplicantunder a food
safety scheme are high risk.(2)Safe
Food must audit the applicant’s program and may grantanaccreditationonlyifSafeFoodissatisfiedtheprogramcomplies with
the scheme.(3)Iftheapplicantisgrantedaccreditation,SafeFoodmustconduct a compliance audit of the
program—(a)within 3 months after accreditation;
and(b)within 6 months after the first
compliance audit.(4)However,ifacriticalnonconformanceisidentifiedatacomplianceaudit,SafeFoodmustconductanadditionalcomplianceauditoftheprogramwithin3monthsafterthecompliance audit.48Audits for renewal of accreditation—low
risk(1)Thissectionappliestoanapplicantforarenewalofaccreditationiftheactivitiescarriedoutbytheapplicantunder a food
safety scheme are low risk.(2)Iftheapplicant’saccreditationisrenewed,SafeFoodmustconduct a compliance audit of the holder’s
program within 1year after the previous compliance
audit.(3)Safe Food must conduct the compliance
audit during the termof the renewed accreditation.(4)However,ifacriticalnonconformanceisidentifiedatacomplianceaudit,SafeFoodmustconductanadditionalcomplianceauditoftheprogramwithin6monthsafterthecompliance audit.(5)Subsections (2) to (4) do not apply if Safe
Food approves analternative verification system in the
applicant’s program.Example of verification system—1monitoring test
resultsCurrent as at 1 January 2014Page
39
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 49]2self
verification3regular inspections49Audits for renewal of
accreditation—medium risk(1)Thissectionappliestoanapplicantforarenewalofaccreditationiftheactivitiescarriedoutbytheapplicantunder a food
safety scheme are medium risk.(2)Iftheapplicant’saccreditationisrenewed,SafeFoodmustconduct a compliance audit of the holder’s
program within 1year after the previous compliance
audit.(3)Safe Food must conduct the compliance
audit during the termof the renewed accreditation.(4)However,ifacriticalnonconformanceisidentifiedatacomplianceaudit,SafeFoodmustconductanadditionalcomplianceauditoftheprogramwithin6monthsafterthecompliance audit.50Audits for renewal of accreditation—high
risk(1)Thissectionappliestoanapplicantforarenewalofaccreditationiftheactivitiescarriedoutbytheapplicantunder a food
safety scheme are high risk.(2)Iftheapplicant’saccreditationisrenewed,SafeFoodmustconduct 2 compliance audits of the holder’s
program duringthe term of the renewed
accreditation.(3)SafeFoodmustconductthecomplianceauditsatleast6months apart.(4)However,ifacriticalnonconformanceisidentifiedatacomplianceaudit,SafeFoodmustconductanadditionalcomplianceauditoftheprogramwithin3monthsafterthecompliance audit.Page 40Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 50A]50ASafe
Food may vary frequency of audits(1)DespitethefrequencyofauditsSafeFoodisrequiredtoconductunderthisdivisionforthegrantorrenewalofanaccreditation for a food safety
scheme, Safe Food may decideto conduct
audits less frequently.(2)Safe Food may
make a decision under subsection (1) if SafeFoodconsidersitisappropriateinthecircumstancesthataudits be conducted less frequently.Example—If an
applicant is applying for renewal of an accreditation under a
foodsafety scheme and the applicant has
demonstrated at previous audits thatthe activities
audited comply with the scheme, Safe Food may decidethat
a compliance audit of the applicant’s program under section
48(2),49(2) or 50(2) is not required.(3)If Safe Food decides to vary the
frequency of audits under thissection, Safe
Food must give the accreditation holder writtennotice of the
decision.Division 4Audits after
minor, major andcritical nonconformances51Identification of minor or major
nonconformance(1)Thissectionappliesif,inanauditor’sopinion,theauditoridentifies a
minor nonconformance or major nonconformanceof an
accreditation holder’s program at a compliance audit.(2)Theauditormust,within14daysaftercompletionoftheaudit,prepareacorrectiveactionrequest(aCAR)thatcomplies with subsection (3) and give a copy
of the CAR to—(a)Safe Food; and(b)the
holder.Maximum penalty—20 penalty units.(3)The CAR must include the following
information—Current as at 1 January 2014Page
41
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 52](a)theactivitiesoftheholder’sprogramthatconstituteaminor or major nonconformance;(b)theactiontheholdermusttaketocorrectthenonconformance and the period within which
the actionmust be taken;(c)whether the auditor needs to conduct a
further audit (anonconformanceaudit)tocheckthatthenonconformance has been corrected;(d)ifanonconformanceauditisneeded,whentheauditmust be
conducted.Maximum penalty—20 penalty units.(4)If a nonconformance audit is needed,
the auditor must conductthe audit by the day stated in the
CAR.Maximum penalty—20 penalty units.(5)If, in the auditor’s opinion, a
nonconformance audit identifiesthat the minor
nonconformance or major nonconformance hasnotbeencorrected,theauditormayconductafurthernonconformance
audit.(6)A nonconformance audit is in addition
to a compliance auditof the holder’s program.52Identification of critical
nonconformance(1)Thissectionappliesif,inanauditor’sopinion,theauditoridentifiesacriticalnonconformanceofanaccreditationholder’s program
at a compliance audit.(2)The auditor
must, unless the auditor has a reasonable excuse,informSafeFoodimmediatelyaftertheauditorformstheopinion.Maximum
penalty—50 penalty units.(3)TheauditormustprepareaCARthatcomplieswithsubsection (4)
and give a copy of the CAR to—(a)Safe
Food; andPage 42Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 5 Monitoring compliance with food safety
schemes[s 52](b)the
holder.Maximum penalty—20 penalty units.(4)The CAR must include the following
information—(a)theactivitiesoftheholder’sprogramthatconstituteacritical nonconformance;(b)theactiontheholdermusttaketocorrectthenonconformance and the period within which
the actionmust be taken;(c)thattheauditorneedstoconductanonconformanceaudit;(d)when the nonconformance audit must be
conducted.(5)Theauditormustconductthenonconformanceauditbytheday stated in
the CAR.Maximum penalty—50 penalty units.(6)If,intheauditor’sopinion,thenonconformanceauditidentifiesthatthecriticalnonconformancehasnotbeencorrected, the
auditor must—(a)unless the auditor has a reasonable
excuse, inform SafeFood immediately after the auditor forms the
opinion;and(b)conductanyfurthernonconformanceauditatthedirection of
Safe Food.Maximum penalty—50 penalty units.(7)A nonconformance audit is in addition
to a compliance auditof the holder’s program.Current as at 1 January 2014Page
43
Food
Production (Safety) Regulation 2002Chapter 2 Food
safety schemesPart 6 General provision[s 53]Division 5Nonconformance
with managementstatements53Identification of nonconformance with
managementstatement(1)This
section applies if Safe Food is satisfied it has identifiedanynonconformancewiththerequirementsofanaccreditation holder’s management
statement.(2)Safe Food may give the accreditation
holder a notice stating—(a)the
nonconformance; and(b)thattheholdermusttakeactiontoremedythenonconformance and the period within which
the actionmust be taken.(3)The
accreditation holder must comply with the notice.Maximum penalty—20 penalty units.Part
6General provision54Review of food safety scheme(1)The Minister must review each food
safety scheme within 5years from the day the scheme comes
into force.(2)However, the Minister must start a
review of chapter 3, part 3of the dairy
scheme within 1 year from the day the part comesinto
force.Page 44Current as at 1
January 2014
Chapter 3Food Production
(Safety) Regulation 2002Chapter 3 Dairy schemePart
1 Contents of dairy scheme[s 55]Dairy
schemePart 1Contents of
dairy scheme55Dairy scheme applies for dairy
produce(1)Thedairyproducefoodsafetyscheme(thedairyscheme)appliesfordairyproduceintendedforhumanoranimalconsumption.(2)However, the dairy scheme does not apply for
the processingof dairy produce intended for consumption by
an animal, ifthe animal, or any part or product of the
animal, is intendedfor human consumption.56Meaning ofdairyproduce—Act, s 8(1)For section 8(a) of the Act, the milk
of buffalo is prescribed.(2)For section 8(b)
of the Act, the following dairy products areprescribed—(a)flavoured milk;(b)cream and thickened cream;(c)butter,butterconcentrate,buttermilk,concentratedbuttermilk,dairyblend,ghee(clarifiedbutter),anhydrous milk fat (butter oil);(d)casein, caseinate and cheese;(e)whey, whey cream and concentrated whey
cream;(f)cultured milk and yoghurt;(g)ice-cream and ice-cream mix;(h)buttermilkpowder,lactosepowder,milksugar,powdered milk, skim milk powder, whey
powder, milkprotein powder and other milk
concentrates;(i)colostrum.Current as at 1
January 2014Page 45
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 1 Contents of dairy scheme[s
57]57Production of dairy produce for which
dairy schemeapplies(1)The
dairy scheme applies for the following—(a)milking an animal at a dairy;(b)processing milk at a dairy;(c)storing milk at a dairy;(d)rearing an animal at a dairy for
milking at the dairy;(e)growingstockfoodatadairyforconsumptionbyananimal to be milked at the
dairy;(f)transporting dairy produce—(i)from a dairy to a factory; or(ii)fromafactorytoanotherfactoryforfurtherprocessing;
or(iii)to or from a
depot; or(iv)within a
factory;(g)handling or storing milk at a depot
before transportingthe milk to a factory for processing;(h)processing dairy produce;Examples for paragraph (h)—•pasteurisation of
milk•homogenisation of milk•manufacture of cheese(i)processing, supplying or selling pet
food;(j)treatingwithdrugsandpesticidesananimaltobemilked at a dairy;(k)producing goat milk for human
consumption.(2)However, the dairy scheme does not
apply to the following—(a)growingstockfoodataplaceotherthanadairyforconsumption by an animal to be milked at a
dairy;Page 46Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 1A Categories of accreditation and
programs[s 57A](b)supplying stock food to a dairy for
consumption by ananimal to be milked at the dairy;(c)transporting stock food for
consumption by an animal tobe milked at a
dairy;(d)rearing an animal to be supplied to a
dairy for milking;(e)transporting an animal to a dairy for
milking;(f)transportingdairyproducefromafactorytoawholesaler or retailer;(g)retail sales of dairy produce, other
than pet food;(h)manufacturing ice-cream if retail
sales of the ice-creamare made from the retail premises
where the ice-cream isproduced.Part 1ACategories of accreditation andprograms57ACategories of accreditationA
person may be accredited under the dairy scheme in eitherof
the following categories—(a)processor;(b)producer.57BRequirement for program or management
statement(1)An applicant for a grant or renewal of
an accreditation underthe dairy scheme as a processor must
prepare a program underthe scheme.(2)An
applicant for a grant or renewal of an accreditation underthe
dairy scheme as a producer must prepare a managementstatement under the scheme.Current as at 1 January 2014Page
47
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 2 Food safety requirements[s
58]Part 2Food safety
requirementsDivision 1Preliminary58Application of pt 2(1)Thispartappliesforfoodsafetyrequirementsforthedairyscheme.Editor’s note—See
part 3 for additional requirements for an accreditation holder
underthe part.(2)Subjecttosubsection(3),thefoodsafetyrequirementsmentioned in
chapter 2, part 4 apply in addition to the foodsafety
requirements mentioned in this part.(3)The
food safety requirements in chapter 2, part 4, division 3donotapplytoanaccreditationholderwhoproducesmilkfrom
an animal at a dairy.58AComplying with
compulsory or advisory standard(1)Ifacompulsorystandardmentionedinschedule2,part1states a requirement for a provision under
this part, a programormanagementstatementunderthedairyschememustcomply with the
compulsory standard for the requirement.(2)If
an advisory standard mentioned in schedule 2, part 2 statesarequirementforaprovisionunderthispart,aprogramormanagement statement under the dairy scheme
must complywith the advisory standard for the
requirement.Note—See section 5
(Complying with compulsory standard) or 6 (Complyingwith
advisory standard) for how a program or management statementunder
a food safety scheme complies with a compulsory or advisorystandard.Page 48Current as at 1 January 2014
Division 2Food Production
(Safety) Regulation 2002Chapter 3 Dairy schemePart
2 Food safety requirements[s 59]Dairy produce at
dairiesSubdivision 1Preliminary59Application of div 2This division
applies to an accreditation holder who producesmilk from an
animal at a dairy.59AGeneral food safety requirement for
production ofmilk at dairyThe
accreditation holder must ensure the production of milkfromananimalattheholder’sdairycomplieswiththecompulsory standard for the production
of milk.Maximum penalty—20 penalty units.Subdivision 2All dairy
produce60Animals to be milked must be free of
disease(1)This section applies for an
animal—(a)reared at a dairy for milking at the
dairy; or(b)brought from another place for milking
at a dairy.(2)The holder must not obtain milk from
an animal the holderknows, or ought reasonably to know, is
affected by a disease,if the milk from the animal may be
unacceptable.Maximum penalty—20 penalty units.(3)Theholdermustkeeprecordstotraceeachanimaltobemilkedtoensureonlyananimalnotaffectedbydiseaseismilked.Examples of
records—1seller’s
declaration if an animal is brought from another placeCurrent as at 1 January 2014Page
49
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 2 Food safety requirements[s
61]2identification of an animal treated at
a dairy3recordofaveterinarychemicalproductanddrugtreatment,treatment date,
dosage and withholding period for an animal4record showing compliance with withholding
period for an animal61Stock food for consumption by animals
to be milked(1)The holder must not feed stock food to
an animal to be milkediftheholderknows,oroughtreasonablytoknow,thefoodmay introduce a
risk of contaminating the milk.Maximum
penalty—20 penalty units.(2)Without limiting
subsection (1), stock food must not containmicrobiological
or chemical hazards at levels greater than theMRLs stated in
the compulsory standard for the requirement.(3)The
holder must keep records to trace stock food purchased toensure only appropriate stock food is
used.Examples of records—1seller’s declaration if stock food is
brought from another place2paddock
identification or storage facility of treated stock food3record of a chemical product or drug
treatment, treatment date,application rate and withholding
period for stock food4record showing
compliance with withholding period for stock foodtreated62Milk
supplied must be free of chemical contaminants(1)The
holder must not supply milk for the processing of dairyproduce at a place other than a dairy
if—(a)the holder knows, or ought reasonably
to know, the milkhas a residue level greater than the MRLs
stated in thecompulsory standard for the requirement;
or(b)the milk has been obtained from an
animal that has beentreated for a disease or illness if
the animal’s treatmentdoes not comply with theChemical Usage (Agriculturaland
Veterinary) Control Act 1988, part 2.Page
50Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 2 Food safety requirements[s
63]Maximum penalty—20 penalty units.(2)Theholdermustkeeprecordsforthepurposeoftracinganimalstobemilkedtoensureonlymilkthatisnotcontaminated is
used.Examples of records—1identification of a treated
animal2record showing chemical products
approved by the APVMA onlyhave been used for an animal3record of a chemical product or drug
treatment, treatment date,dosage and withholding period for milk
from a treated animal4record showing
compliance with withholding period for milk froma
treated animal63Production and storage of milkThe
holder may obtain milk from an animal and store the milkonlyinawayandusingequipmentthatpreventsthecontaminationofthemilkfromforeignmatterandhazardsthat may make
the milk unacceptable.Maximum penalty—20 penalty
units.64Temperature control for stored
milkThe holder must store milk at a temperature
that restricts thedevelopment of microbiological hazards in
the milk.Maximum penalty—20 penalty units.65Health and hygiene requirements(1)Theholdermustensureallpersonsmilkinganimalsatthedairy maintain a high level of health
and hygiene practices toprevent contamination of the
milk.Maximum penalty—20 penalty units.(2)Measures a holder must take under
subsection (1) include—Current as at 1 January 2014Page
51
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 2 Food safety requirements[s
66](a)providing adequate health and hygiene
facilities at thedairy and ensuring their appropriate use by
the personsmilking the animals; and(b)establishing and maintaining appropriate
procedures andpractices for health and hygiene.Subdivision 3Dairy produce
other thanunpasteurised goat milk66Design, construction and maintenance of
dairy andequipment(1)This
section applies to an accreditation holder, other than anaccreditation holder who, under part 3,
produces goat milk.(2)The holder must ensure the holder’s
dairy and equipment usedtoobtainandstoremilkfromananimalaredesignedandconstructedwithappropriatematerialstominimisetothegreatestpossibleextenttheintroductionofcontaminantstothe
milk.Maximum penalty—20 penalty units.(3)Also, the holder must ensure the
holder’s dairy and equipmentare kept clean
and in good repair.Maximum penalty—20 penalty units.Division 3Processing dairy
produce at depotsor factories67Application of div 3This division
applies to an accreditation holder who processesdairy produce at a depot or factory.Page
52Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 2 Food safety requirements[s
68]68Receiving dairy produce for
processing(1)This section applies to the holder who
accepts from a persondairy produce for processing.(2)The holder accepting the produce must
take all practical stepsto ensure the produce—(a)is,orhasbeen,protectedfromthelikelihoodofcontamination; and(b)doesnotcontaincontaminantsgreaterthantheMRLsstated in the
compulsory standard for the requirement.Maximum
penalty—20 penalty units.(3)The holder must
keep records of—(a)thenameandaddressofthepersonwhosuppliedthedairy produce; and(b)the
details and results of the testing done to determinethe
acceptability of the produce; and(c)anyotherdocumentshowingtheholderhascompliedwith subsection
(2).69General food safety requirement for
processing dairyproduce at depot or factory(1)The holder must process dairy produce
at the holder’s depot orfactory in a way that complies with
the compulsory standardfor the processing of the dairy
produce.Maximum penalty—20 penalty units.(2)Withoutlimitingsubsection(1),theholdermustpasteurisemilkorprocessdairyproduceusingequipmentthatisappropriate for the pasteurisation or
other processing.70Storing dairy produceIf
the holder stores dairy produce at a place other than a
dairy,the holder must ensure the produce
is—Current as at 1 January 2014Page
53
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 2 Food safety requirements[s
71](a)protected from the likelihood of
contamination; and(b)keptunderenvironmentalconditionsandtemperaturecontroltomaintaintheacceptabilityofthedairyproduce.Maximum penalty—20 penalty units.71Minimum standard for dairy produce for
humanconsumptionIf the holder
processes dairy produce for human consumption,the holder must
ensure the produce—(a)does not contain—(i)microbiological levels greater than the
levels statedin the compulsory standard for the
requirement; or(ii)chemical hazards
at levels greater than the MRLsstatedinthecompulsorystandardfortherequirement;
and(b)has the composition stated for the
dairy produce in thecompulsory standard for the
requirement.Maximum penalty—20 penalty units.72Supplying dairy produceThe
holder must not supply the dairy produce to a person ifthe
holder knows, or ought reasonably to know, the processingor
the produce has not complied with the compulsory standardfor
the requirement.Maximum penalty—20 penalty units.73Testing after processingThe
holder must put into effect and use a testing program fordairy produce processed at the holder’s
factory to ensure thePage 54Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 3 Goat milk[s 74]acceptabilityoftheproducecomplieswiththecompulsorystandard for the
requirement.Maximum penalty—20 penalty units.Part
3Goat milkDivision 1Production of unpasteurised goatmilk74Application of pt
3Thispartappliestoanaccreditationholderwho,underthispart, produces
goat milk intended for human consumption ifthe goat
milk—(a)is not pasteurised; and(b)is not sent to a factory for
processing.75Aspects of production of goat milk for
which pt 3 applies(1)This part applies for the
following—(a)milking a goat at a dairy;(b)storing goat milk at a dairy;(c)rearing a goat at a dairy for milking
at the dairy;(d)growing stock food at a dairy for
consumption by a goatto be milked at the dairy;(e)treating with drugs and pesticides a
goat to be milked ata dairy;(f)packaging and labelling goat milk at a
dairy;(g)retail sales of goat milk if the milk
is sold from the dairywhere the goat was milked.Current as at 1 January 2014Page
55
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 3 Goat milk[s 76](2)However, this part does not apply for
the following—(a)growingstockfoodataplaceotherthanadairyforconsumption by a goat to be milked at a
dairy;(b)supplyingortransportingstockfoodtoadairyforconsumption by a goat to be milked at the
dairy;(c)rearing a goat to be supplied to a
dairy for milking;(d)producing goat milk for human
consumption if the milkis sent to a factory for
processing;(e)retailsalesofgoatmilkifthemilkissoldotherthanfrom the dairy
where the goat was milked.Division 2Application of
dairy scheme76Complying with dairy schemeThe
holder must comply with the requirements of the dairyscheme, other than section 66.Division 3Food safety
requirements77General requirements for production of
goat milkTheholdermustproducegoatmilkaccordingtothecompulsory
standard for the requirement.Maximum
penalty—20 penalty units.78Design,
construction and maintenance of dairy andequipmentTheholdermustensurethedairyandtheequipmentatthedairycomplywiththecompulsorystandardfortherequirement.Maximum
penalty—20 penalty units.Page 56Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 3 Goat milk[s 79]79Supply of goat milk for human
consumptionThe holder must not supply the goat milk to
a person if theholder knows, or ought reasonably to know,
the holder has notcomplied with section 77 for the goat
milk.Maximum penalty—20 penalty units.Division 4Testing and
product recall80Standard for testing and frequency of
testingThe holder at a dairy must comply with the
following in theholder’s program—(a)the
testing program for goat milk produced at the dairyto
ensure the goat milk complies with the compulsorystandard for the requirement;(b)the frequency of testing for goat
milk.Maximum penalty—50 penalty units.81Conducting tests(1)The
holder must ensure a test for a substance in goat milk isconducted by a laboratory accredited by NATA
to conduct thetest.Maximum
penalty—20 penalty units.(2)In this
section—NATAmeans the
National Association of Testing Authorities,Australia.82Test
results sent to Safe FoodThe holder must send the results of a
test to Safe Food within7daysafterthelaboratoryconductingthetestnotifiestheholder of the test results.Current as at 1 January 2014Page
57
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 3 Goat milk[s 83]Maximum penalty—20 penalty units.83Safe Food conducts random
checksSafeFoodmayconductrandomchecksortakesamplesofgoat milk produced to ensure the
holder is complying with theholder’s
program.84Product recall(1)Theholdermust,forgoatmilkproduced,implementandmaintainaproductrecallprogramthatcomplieswiththeFSANZ industry recall program.Maximum penalty—20 penalty units.(2)In this section—FSANZ industry
recall programmeans a guideline issued byFood
Standards Australia and New Zealand, established undertheAustralia New Zealand Food Authority
Act 1991(Cwlth),about ways of
complying with recall procedures.Division 5Labelling85Labelling goat milk(1)The
holder must comply with the requirements in subsections(2)
to (4) for labelling goat milk.Maximum
penalty—20 penalty units.(2)The goat milk
must be labelled according to the compulsorystandard for the
requirement.(3)The label on a package containing goat
milk must include thestatement‘Caution—Thismilkisanunpasteurisedproductand
may contain organisms that could be injurious to health.’.(4)The statement must be—(a)in standard type of at least 3mm in
height; andPage 58Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 3 Dairy
schemePart 4 Labelling pet food[s 87](b)inacolourcontrastingdistinctlywiththebackgroundcolour of the
label or packaging; and(c)conspicuous to a
person looking at the label.Part 4Labelling pet food87Labelling requirements for pet food(1)An accreditation holder who labels pet
food must comply withthe requirements in subsections (2) to
(4) for the labelling ofthe pet food.Maximum
penalty—20 penalty units.(2)The label on a
package containing the pet food must includethe statement
‘Animal Food Only’ in standard type of at least6mm in
height.(3)Thestatementmustbeimmediatelyfollowedbyanotherstatement ‘Not
fit for human consumption’ in standard type ofat least 3mm in
height.(4)Thestatementsmentionedinsubsections(2)and(3)mustbe—(a)inacolourcontrastingdistinctlywiththebackgroundcolour of the
label or packaging; and(b)conspicuous to a
person looking at the label.Current as at 1
January 2014Page 59
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 1 Contents of egg scheme[s
87A]Chapter 3AEgg schemePart
1Contents of egg scheme87AEgg
scheme applies for eggs and egg productsThe egg food
safety scheme (theegg scheme) applies for
eggsand egg products intended for human or
animal consumption.87BProduction of eggs and egg products
for which eggscheme appliesThe egg scheme
applies for the production of eggs and eggproducts,
including, for example, the following—(a)rearingabirdataneggproductionfarmforeggproduction;(b)growingstockfoodataneggproductionfarmforconsumption by a bird to be used for
egg production;(c)producingeggsataneggproductionfarm,includingunder a
preferred supplier arrangement;(d)storing eggs at an egg production farm, egg
processingfacility or wholesaler’s premises;(e)transporting eggs or egg
products—(i)from an egg production farm to an egg
processor orwholesaler; or(ii)from
an egg processor to a wholesaler; or(iii)from
a wholesaler to an egg processor; or(iv)withinaneggproductionfarm,eggprocessingfacility or
wholesaler’s premises; or(v)from an egg
producer, egg processor or wholesalerto a retailer,
manufacturer or commercial user;Page 60Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 1 Contents of egg scheme[s
87C](f)handlingeggsoreggproductsataneggproductionfarm, egg
processing facility or wholesaler’s premises;(g)washing and grading eggs, including
assessing eggs forcracks;(h)off-farm sales of eggs;(i)processing eggs to produce egg
products;(j)pasteurising egg products.87CProduction of eggs and egg products
for which eggscheme does not applyDespite section
87B, the egg scheme does not apply for thefollowing—(a)growing or supplying stock food at a place
other than aneggproductionfarmforconsumptionbyabirdtobeused for egg production;(b)transporting stock food at or from a
place other than aneggproductionfarmforconsumptionbyabirdtobeused for egg production;(c)rearing a bird at a place other than
an egg productionfarm for egg production;(d)rearing a bird as a pet or for breeding for
show;(e)retailsalesofeggs(otherthanoff-farmsales),forhuman consumption;(f)anyothersupplyofeggsoreggproductsbyamanufacturer or commercial
user.Current as at 1 January 2014Page
61
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 1A Categories of accreditation, programs
and management statements[s 87CA]Part 1ACategories of accreditation,programs and managementstatements87CACategories of accreditationA
person may be accredited under the egg scheme in any ofthe
following categories—(a)processor;(b)producer;(c)transporter.87CBRequirement for program or management
statement(1)An applicant for a grant or renewal of
an accreditation underthe egg scheme as a processor must
prepare a program underthe scheme.(2)An
applicant for a grant or renewal of an accreditation underthe
egg scheme as a producer or transporter must prepare amanagement statement under the
scheme.Part 2Food safety
requirementsDivision 1Preliminary87DApplication of pt 2(1)Thispartappliesforfoodsafetyrequirementsfortheeggscheme.(2)The food safety requirements mentioned
in chapter 2, part 4apply in addition to the food safety
requirements mentioned inPage 62Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 2 Food safety requirements[s
87DA]this part.(3)Despitesubsection(2),ifanactivitymentionedinsection87B(a)or(b)iscarriedoutinalocationthatisphysicallyseparatefromwhereanotheractivitymentionedinsection87B is carried
out, the requirement stated in section 38 is theonly
food safety requirement that applies to the activity.87DAComplying with compulsory or advisory
standard(1)Ifacompulsorystandardmentionedinschedule3A,part1states a requirement for a provision under
this part, a programor management statement under the egg
scheme must complywith the compulsory standard for the
requirement.(2)Ifanadvisorystandardmentionedinschedule3A,part2states a requirement for a provision under
this part, a programor management statement under the egg
scheme must complywith the advisory standard for the
requirement.Note—See section 5
(Complying with compulsory standard) or 6 (Complyingwith
advisory standard) for how a program or management statementunder
a food safety scheme complies with a compulsory or advisorystandard.Division 2GeneralSubdivision
1Information requirements87EInformation to be contained in food safety
program—Act,s 41(2)(f)(1)This
section applies if the activities carried out, or proposed
tobe carried out, by an accreditation holder
or applicant for anaccreditation include the production of eggs
or egg productsfor supply.Current as at 1
January 2014Page 63
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 2 Food safety requirements[s
87G](2)Theperson’sfoodsafetyprogrampreparedundertheeggscheme must state the person’s egg
production identification.Subdivision 2Egg production
activities87GBirds must be free of diseaseAnaccreditationholdermustnotobtaineggsforhumanoranimal consumption from a bird the person
knows, or oughtreasonably to know, is affected by a
disease, if the eggs maybe unsafe.Maximum
penalty—50 penalty units.Example of disease—Salmonella enteritidis87HStock
food for consumption by birds(1)Anaccreditationholdermustnotfeedstockfoodtoabirdusedforeggproductioniftheholderknows,oroughtreasonablytoknow,thefoodmayintroduceariskofcontaminating the eggs.Maximum
penalty—50 penalty units.(2)Without limiting
subsection (1), stock food must not containmicrobiological
or chemical hazards at levels greater than theMRLs stated in
the compulsory standard for the requirement.87IEggs
supplied must be free of chemical contaminantsAn accreditation
holder must not supply eggs for human oranimalconsumptioniftheholdersuspects,oroughtreasonably to
suspect—(a)theeggshavearesiduelevelgreaterthantheMRLsstated in the
compulsory standard for the requirement;orPage
64Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 2 Food safety requirements[s
87J](b)the eggs have been obtained from a
bird that has beentreatedforadiseaseorillness,ifthebird’streatmentdoes
not comply with theChemical Usage (Agriculturaland
Veterinary) Control Act 1988, part 2.Maximum penalty—50 penalty units.87JIdentifying eggs and egg
products(1)An accreditation holder who produces
eggs must not supplytheeggsunlesstheholderhasmarkedeachegg,andeachcarton or
package containing the eggs, with the holder’s eggproductionidentificationinthewaystatedintheholder’sapproved program.Maximum
penalty—50 penalty units.(2)An accreditation
holder who produces egg products must notsupplytheproductsunlesstheholderhasmarkedeachpackagecontainingtheproductwiththeholder’seggproductionidentificationinthewaystatedintheholder’sapproved program.Maximum
penalty—50 penalty units.87KSupplying
eggs(1)A person must not supply an egg for
sale if the person knows,or ought reasonably to know, its
shell—(a)is cracked; or(b)has
visible faeces, soil or other matter on it.Maximum penalty
for subsection (1)—50 penalty units.(2)Subsection (1) does not apply if the person
supplies the egg toanaccreditationholderforprocessingtheeggandpasteurising the
egg product.(3)Also, if the person is an
accreditation holder, it is a defencefor the person
to prove the person complied with the person’sapproved program
in producing the egg.Current as at 1 January 2014Page
65
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 2 Food safety requirements[s
87L](4)An accreditation holder who supplies
eggs under a preferredsupplier arrangement must not supply
eggs other than underthe arrangement.Maximum
penalty—50 penalty units.87LSupplying egg
products(1)A person must not supply an egg
product the person knows, orought reasonably
to know, has not been pasteurised.Maximum
penalty—50 penalty units.(2)Subsection (1)
does not apply if the person supplies the eggproducttoanaccreditationholderforpasteurisingtheeggproduct.87MPasteurising egg products(1)A person who produces egg products
must pasteurise the eggproductsaccordingtothecompulsorystandardfortherequirement.Maximum
penalty—50 penalty units.(2)Subsection (1)
does not apply if the person supplies the eggproductstoanaccreditationholderforpasteurisingtheeggproducts.Division 3Records87NTracing birds used in production(1)An accreditation holder who produces
eggs must keep recordsto trace each bird used in the
production to ensure only birdsnot affected by
disease are used.Examples of records—1seller’s declaration if the bird is
brought from another place2identification of
a treated birdPage 66Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 3A Egg
schemePart 2 Food safety requirements[s
87O]3recordofaveterinarychemicalproductanddrugtreatment,treatment date,
dosage and withholding period for a bird4record showing compliance with withholding
period for a bird(2)Also, the holder must keep records to
trace each bird used inthe production to ensure only eggs
that are not contaminatedare used.Examples of
records—1identification of
a treated bird2record showing only chemical products
approved by the AustralianPesticides and Veterinary Medicines
Authority established undertheAgriculturalandVeterinaryChemicals(Administration)Act1992(Cwlth) have been used for the
bird3record of a chemical product and drug
treatment, treatment date,dosage and withholding period for eggs
from the bird4record showing compliance with
withholding period for eggs fromthe bird(3)Further, the holder must keep records
for any supply or receiptof the following—(a)anegg,theshellofwhichiscrackedorhasvisiblefaeces, soil or
other matter on it;(b)an unpasteurised egg product.87OTracing stock foodAn accreditation
holder who produces eggs must keep recordsto trace stock
food purchased for birds used in the productionto ensure only
appropriate stock food is used.Examples of
records—1seller’s
declaration if stock food is brought from another place2paddock identification or storage
facility of treated stock food3record of a chemical product or drug
treatment, treatment date,application rate and withholding
period for stock food4record showing
compliance with withholding period for stock foodtreatedCurrent as at 1
January 2014Page 67
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 1 Contents of meat scheme[s
88]Chapter 4Meat
schemePart 1Contents of meat
scheme88What meat scheme applies forThe
meat food safety scheme (themeat
scheme) applies for—(a)meat(otherthanseafood)intendedforhumanconsumption;
and(b)ready-to-eat meat intended for human
consumption; and(c)petmeat,petmeatproductsandrenderedproductsintended for animal consumption; and(d)poultry intended for human
consumption.89Aspects of production of primary
produce to whichscheme applies(1)The
meat scheme applies for the following—(a)handlingofananimalataplacewheretheanimaliskilled for meat;(b)rearing,orlivetransporting,ofpoultryintendedforhuman consumption;(c)otherhandlingofpoultryintendedforhumanconsumption;(d)processingmeatorready-to-eatmeatintendedforhuman consumption;(e)processing pet meat, a pet meat product or a
renderedproduct;(f)handling, packaging or storing meat or a
meat product;(g)transporting meat obtained from an
animal, at any stagein the production of the meat from
when the animal iskilled to when the meat arrives at relevant
premises—Page 68Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 1 Contents of meat scheme[s
89](i)whether or not the meat is transported
directly tothe relevant premises; and(ii)regardless of
the number of stages of production ofthe meat, the
number of journeys before the meatarrivesattherelevantpremises,thenumberofpremisestowhichthemeatistransportedforproduction and the time taken to transport
the meatto the relevant premises;(h)retailsalesofmeatorameatproductfromthefollowing—(i)meat
retail premises;(ii)a meat retail
vehicle;(i)retail sales of prepackaged meat or a
prepackaged meatproduct if the package is sold
opened.(2)However, the meat scheme does not
apply to the following—(a)rearingananimal,otherthanpoultry,tobekilledformeat;(b)growing, mixing, storing or transporting
stock food forconsumption by an animal to be killed for
meat;(c)handling or transporting an animal,
other than poultry, atany stage before the animal arrives at
an abattoir wherethe animal is killed;(d)transporting meat from premises that are the
first pointofretailsaleofthemeattootherpremiseswherethemeat
is sold;Example—transporting meat from a butcher shop to a
restaurantNote—The meat scheme
applies for transporting meat to a restaurant orsimilar business if the restaurant or
business is the first point ofretail sale of
the meat.(e)handling or transporting ready-to-eat
meat or a renderedproduct after the ready-to-eat meat or
product leave theCurrent as at 1 January 2014Page
69
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 1A Categories of accreditation, programs
and management statements[s 89A]premiseswheretheready-to-eatmeatorproductisprocessed;(f)retail sales of prepackaged meat or a
prepackaged meatproduct if the package is sold
unopened.(3)In this section—relevant
premises, for meat, means—(a)ifthemeatistobeprocessedtoproduceready-to-eatmeat,apetmeatproductorarenderedproduct—premises
where the meat is processed; or(b)otherwise—premises that are the first point
of retail saleof the meat.Example of
premises that are the first point of retail sale—butcher shopPart 1ACategories of accreditation,programs and managementstatements89ACategories of accreditationA
person may be accredited under the meat scheme in any ofthe
following categories—(a)cold store
operator;(b)exporter;(c)game
box operator;(d)processor;(e)producer;(f)retailer;(g)transporter;Page 70Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
89B](h)wild game harvester.89BRequirement for program or management
statement(1)An applicant for a grant or renewal of
an accreditation underthemeatschemeasanyofthefollowingmustprepareaprogram under the scheme—(a)an exporter or processor;(b)a retailer who undertakes a high risk
activity under thescheme.(2)An
applicant for a grant or renewal of an accreditation underthemeatschemeasanyofthefollowingmustprepareamanagement statement under the
scheme—(a)a cold store operator, game box
operator, transporter orwild game harvester;(b)aretailerwhodoesnotundertakeahighriskactivityunder the
scheme;(c)a producer.Part 2Food
safety requirementsDivision 1Preliminary90Application of pt 2(1)Thispartappliesforfoodsafetyrequirementsforthemeatscheme.(2)The food safety requirements mentioned
in chapter 2, part 4apply in addition to the food safety
requirements mentioned inthis part.Current as at 1
January 2014Page 71
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
90A]90AComplying with compulsory or advisory
standard(1)Ifacompulsorystandardmentionedinschedule4,part1states a requirement for a provision under
this part, a programormanagementstatementunderthemeatschememustcomply with the
compulsory standard for the requirement.(2)If
an advisory standard mentioned in schedule 4, part 2 statesarequirementforaprovisionunderthispart,aprogramormanagement statement under the meat scheme
must complywith the advisory standard for the
requirement.Note—See section 5
(Complying with compulsory standard) or 6 (Complyingwith
advisory standard) for how a program or management statementunder
a food safety scheme complies with a compulsory or advisorystandard.Division 2Rearing, capturing and killinganimals for meat91Animal to be killed must come from place
free ofchemical contaminants(1)This
section applies to an accreditation holder who kills formeat—(a)an
animal reared to be killed for meat; or(b)a
wild animal.(2)The holder must not kill the animal if
the holder knows, orought reasonably to know, the animal
has been reared at, orcomes from, a place where chemical
contaminants at the placecouldmakethemeat,ormeatproductsprocessedfromthemeat, unacceptable.Maximum penalty for subsection (2)—20
penalty units.Page 72Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
92]92System for rearing animals at place of
production(1)Thissectionappliestoanaccreditationholderwhokillsananimal that comes from a place of
production.(2)Theholdermust,beforekillingtheanimal,ensureanotherperson in charge
of the place of production implements andmaintainsasystemforrearingtheanimaltoproducemeatfrom
the animal that is acceptable.Maximum penalty
for subsection (2)—20 penalty units.93System for identifying place of capture of
wild animalsAn accreditation holder who kills wild
animals for meat mustimplement and maintain a system that
can identify the placewhere an animal is captured before it
is killed.Maximum penalty—20 penalty units.94Identifying source of animal(1)Anaccreditationholderwhokillsananimalformeatmustkeep
records complying with this section.Maximum
penalty—20 penalty units.(2)The records must
identify—(a)for an animal reared to be killed for
meat—the place ofproduction; or(b)for
a wild animal—(i)the place where the animal is caught;
and(ii)if the animal is
killed in the wild—the place wherethe animal is
killed.Current as at 1 January 2014Page
73
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
95]95Animal appropriate for producing
meatAn accreditation holder who kills an animal
for meat must,before killing the animal, ensure that the
animal is appropriatefor producing meat that is
acceptable.Maximum penalty—20 penalty units.96Adequate lighting at place where wild
animal killedAn accreditation holder who kills wild
animals for meat mustensure there is adequate natural or
artificial lighting—(a)at the place
where the animal is killed; and(b)where the animal is field dressed.Maximum penalty—20 penalty units.Division 3CarcassesSubdivision 1Handling
carcasses and postmortem dispositions97Before post mortem disposition(1)An accreditation holder who kills an
animal for meat must killtheanimalinawaythatensuresanaccuratepostmortemdisposition can
be applied to the animal’s carcass.Maximum
penalty—20 penalty units.(2)An accreditation
holder who dresses an animal must dress theanimalinawaythatensuresanaccuratepostmortemdisposition can
be applied to the animal’s carcass.Maximum
penalty—20 penalty units.Page 74Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
98]98Handling and dressing animalAnaccreditationholderwhohandlesordressesananimalmust handle or
dress the animal in a way that—(a)reducestheriskofcontaminationoftheanimal’scarcass;
and(b)ensuresthecarcassisappropriateforproducingmeatthat
is acceptable.Maximum penalty—20 penalty units.99Meat from carcassAnaccreditationholderwhohandlesacarcassmustensurethe carcass is
not affected by any disease or abnormality thatcould affect the
acceptability of the meat from the carcass.Maximum
penalty—20 penalty units.100Receiving field
dressed animal and carcassAperson,otherthananauthorisedofficer,mayreceiveacarcassoranimalthathasbeenfielddressedonlyfromanaccreditation holder.Maximum
penalty—20 penalty units.101Performing post
mortem disposition(1)An accreditation holder who kills an
animal at premises mustensureapostmortemdispositionisappliedtotheanimal’scarcass before
the carcass is removed from the area where it isdressed.Maximum
penalty—20 penalty units.(2)An accreditation
holder who kills a wild animal for meat mustensureapostmortemdispositionisappliedtotheanimal’scarcassbeforethecarcassisremovedfromtheareaofthevehicle where it is field
dressed.Current as at 1 January 2014Page
75
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
102]Maximum penalty—20 penalty units.102Meat for animal consumption(1)Thissectionappliestoanaccreditationholderwho,whenapplying a post mortem disposition to a
carcass, categorisesmeat from the carcass as meat for
animal consumption.(2)The holder must ensure the following
meat only is included inthe meat for animal
consumption—(a)pet meat;(b)petmeatthathasbeentreatedtodestroyClostridiumbotulinumspores;(c)biologicalmatterthatcanberenderedtoproducearendered product.Maximum
penalty—20 penalty units.(3)The holder must
ensure pet meat that has not been treated todestroyClostridiumbotulinumsporesandbiologicalmatterthathasnotbeen renderedare kept
separate from other petmeat.Maximum
penalty—20 penalty units.Subdivision 2Chilling,
staining and temperaturecontrols for animals and
carcasses103Chilling carcass of animal killed at
abattoir(1)This section applies to an
accreditation holder who dresses ananimal if the
animal is killed at an abattoir.(2)After dressing the animal, the holder
must—(a)chill the animal’s carcass to a
temperature and within aperiodthatensurestheacceptabilityofmeatfromthecarcass is not affected; and(b)maintain the carcass at the
temperature.Page 76Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
104]Maximum penalty—20 penalty units.104Chilling animal killed in the
wild(1)An accreditation holder who field
dresses an animal killed inthe wild
must—(a)chill the animal to a temperature and
within a period thatensures the acceptability of meat from
the animal is notaffected; and(b)maintain the animal at the
temperature.Maximum penalty—20 penalty units.(2)If an accreditation holder who field
dresses an animal killed inthewildgivestheanimalto
anotheraccreditationholdertochill the animal, the other
accreditation holder must—(a)chill the animal
to a temperature and within a period thatensures the
acceptability of meat from the animal is notaffected;
and(b)maintain the animal at the
temperature.Maximum penalty—20 penalty units.105Receiving animal killed in the
wild(1)This section applies to an
accreditation holder who receives ananimal that has
been field dressed if the animal is killed in thewild.(2)After receiving the animal, the holder
must—(a)chill the animal to a temperature and
within a period thatensures the acceptability of meat from
the animal is notaffected; and(b)maintain the animal at the
temperature.Maximum penalty—20 penalty units.Current as at 1 January 2014Page
77
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
106]106Staining meat for animal
consumption(1)This section applies to an
accreditation holder who processesan animal’s
carcass.(2)As soon as possible after receiving
the animal, the holder muststainthemeatfromtheanimal’scarcassthatisforanimalconsumption.Maximum
penalty—20 penalty units.(3)The meat must be
stained in a way that the meat is—(a)clearly identified as for animal
consumption; and(b)not likely to be accidentally used or
substituted for meator ready-to-eat meat for human
consumption.Maximum penalty—20 penalty units.(4)Subsection(2)doesnotapplyifSafeFoodapprovesanalternativeidentificationsystemintheholder’sprogramormanagement statement.107Maintaining temperature of carcassAfter an accreditation holder has chilled a
carcass, the holdermust keep the carcass at a temperature that
ensures meat fromthe carcass is acceptable.Maximum penalty—20 penalty units.Page
78Current as at 1 January 2014
Division 4Food Production
(Safety) Regulation 2002Chapter 4 Meat schemePart
2 Food safety requirements[s 108]Further
processingSubdivision 1Meat and meat
products for humanand animal consumption108Further processing of meat and pet
meatAnaccreditationholderprocessingmeatorpetmeattoproduce ready-to-eat meat or a pet
meat product must ensurethe processing—(a)destroys pathogens; or(b)reduces pathogenic growth to a level that
does not affectthe acceptability of the meat or
product.Maximum penalty—20 penalty units.Subdivision 2Meat and
ready-to-eat meat forhuman consumption109Application of sdiv 2Thissubdivisionappliesformeat andready-to-eatmeatforhuman consumption.109AGeneral food safety requirement for the
production ofready-to-eat meatAn accreditation
holder who is engaged in the production ofready-to-eat
meat must ensure the production complies withthecompulsorystandardfortheproductionofready-to-eatmeat.Current as at 1 January 2014Page
79
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
110]110Receiving contaminated meat,
ready-to-eat meat andingredients(1)An
accreditation holder who receives meat, ready-to-eat meatoraningredientusedformakingready-to-eatmeatmustassess
if—(a)themeat,ready-to-eatmeatoringredientiscontaminated; and(b)time
or temperature controls have been complied withwhenthemeat,ready-to-eatmeatoringredientwastransported to the holder’s premises for
processing.Maximum penalty—20 penalty units.(2)Iftheholderassessesthemeat,ready-to-eatmeatoringredient could be contaminated, the
holder must ensure themeat, ready-to-eat meat or ingredient
is—(a)clearly identified as not for human
consumption; and(b)kept separate from, and does not
affect the acceptabilityof, other meat or ready-to-eat
meat.Maximum penalty—20 penalty units.111Identifying and separating meat not
for humanconsumptionAn accreditation
holder processing meat or ready-to-eat meatmust ensure meat
not for human consumption is—(a)clearly identified as not for human
consumption; and(b)kept separate from, and does not
affect the acceptabilityof, other meat or ready-to-eat
meat.Maximum penalty—20 penalty units.Page
80Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
112]112Ingredients used for processing meat
and ready-to-eatmeatAnaccreditationholderwhousesaningredientintheprocessingofmeatorready-to-eatmeatmustensuretheingredient used or to be used—(a)is appropriate for the purpose for
which it is used or tobe used; and(b)doesnotmakethemeatorready-to-eatmeatunacceptable; and(c)is
labelled, stored and handled in a way that—(i)prevents its misuse; and(ii)easily identifies it.Maximum
penalty—20 penalty units.113Hazardous
materialAn accreditation holder who processes meat
or ready-to-eatmeat must ensure hazardous material used, or
to be used—(a)is appropriate for the purpose for
which it is used or tobe used; and(b)doesnotmakethemeatorready-to-eatmeatunacceptable; and(c)is
labelled, stored or handled in a way that—(i)prevents its misuse; and(ii)easily identifies it.Maximum
penalty—20 penalty units.114Contamination of
meat and ready-to-eat meatAn accreditation holder processing
meat or ready-to-eat meatat a place must ensure the meat or
ready-to-eat meat are notcontaminatedbyanexternalenvironmentalconditionoraprocessing
activity at the place.Current as at 1 January 2014Page
81
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
115]Maximum penalty—20 penalty units.115Contamination of ready-to-eat meat by
meatAnaccreditationholderprocessingready-to-eatmeatfrommeatmustensurethemeatorready-to-eatmeatarenotcontaminated by
other meat.Maximum penalty—20 penalty units.Subdivision 3Pet meat, pet
meat products andrendered products for animalconsumption116Application of sdiv 3This subdivision
applies for pet meat, a pet meat product andrendered product
for animal consumption.117Receiving
contaminated pet meat, pet meat products andingredients(1)Anaccreditationholderwhoreceivespetmeat,apetmeatproductoraningredientusedforprocessingapetmeatproduct must
assess if—(a)the meat, product or ingredient is
contaminated; and(b)time or temperature controls have been
complied withwhen the meat, product or ingredient was
transported tothe holder’s premises.Maximum
penalty—20 penalty units.(2)Iftheholderassessesthepetmeat,petmeatproductoringredient could be contaminated, the
holder must ensure themeat, product or ingredient is—(a)clearly identified as not for animal
consumption; andPage 82Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
118](b)kept separate from, and does not
affect the acceptabilityof, other meat or products.Maximum penalty—20 penalty units.118Identifying and separating meat for
animal consumptionand unacceptable meatAnaccreditationholderprocessingpetmeat,apetmeatproduct or a
rendered product at premises must ensure—(a)the
meat or product is—(i)clearly identified as for animal
consumption; and(ii)keptseparatefrom,anddoesnotaffecttheacceptabilityof,meatorready-to-eatmeatforhuman consumption; and(b)unacceptable meat is—(i)clearlyidentifiedasnotforanimalconsumption;and(ii)keptseparatefrom,anddoesnotaffecttheacceptability of, other meat or
products.Maximum penalty—20 penalty units.119Ingredients used for processing pet
meatAnaccreditationholderwhousesaningredientintheprocessingofpetmeat,apetmeatproductorarenderedproduct must ensure the ingredient used or
to be used—(a)is appropriate for the purpose for
which it is used or tobe used; and(b)does
not make the meat or product unacceptable; and(c)is
labelled, stored and handled in a way that—(i)prevents its misuse; and(ii)easily identifies it.Current as at 1
January 2014Page 83
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
120]Maximum penalty—20 penalty units.120Hazardous materialAn accreditation
holder who processes pet meat, a pet meatproductorrenderedproductatpremisesmustensurehazardous
material used or to be used at the premises—(a)is
appropriate for the purpose for which it is used or tobe
used; and(b)does not make the meat or product
unacceptable; and(c)is labelled, stored or handled in a
way that—(i)prevents its misuse; and(ii)easily
identifies it.Maximum penalty—20 penalty units.121RenderingAn accreditation
holder who renders biological material froman animal must
ensure the rendering—(a)destroys
pathogens; or(b)reduces pathogenic growth to a level
that does not affectthe acceptability of the rendered
product.Maximum penalty—20 penalty units.122Contamination of pet meat, pet meat
products andrendered productsAnaccreditationholderprocessingpetmeat,apetmeatproductorarenderedproductatpremisesmustensurethemeatorproductisnotcontaminatedbyanexternalenvironmentalconditionoraprocessingactivityonthepremises.Maximum penalty—20 penalty units.Page
84Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
123]123Contamination of pet meat product by
pet meatAn accreditation holder processing a pet
meat product frompetmeatmustensurethepetmeatorproductisnotcontaminated by other pet meat.Maximum penalty—20 penalty units.124Contamination of rendered
productAn accreditation holder processing a
rendered product mustensure the product is not contaminated
by meat or other meatproduct that has not been
rendered.Maximum penalty—20 penalty units.Division 5Packaging,
identifying, storing,handling and displaying meat
andmeat products125Packaging and prepackaging meat and meat
products(1)An accreditation holder who packages
or prepackages meat ora meat product must package and
identify the meat or productso that—(a)the packaging and identification of
the meat or productis appropriate for the purpose; and(b)the acceptability of the meat or
product is not affected.Maximum penalty—20 penalty
units.(2)Withoutlimitingsubsection(1),forprepackagedmeatorameat product,
the packaging must protect the meat or productfrom
contamination when storing, handling and transporting.126Storing, handling and displaying meat
and meat productsAn accreditation holder who stores, handles
or displays meator a meat product must store, handle or
display the meat orCurrent as at 1 January 2014Page
85
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
127]product under conditions that ensure the
acceptability of themeat or product is not
affected.Maximum penalty—20 penalty units.127Identifying and labelling meat and
meat products fortransportationA person
transporting meat or a meat product must ensure themeat
or product is identified, labelled or kept separate fromanother product in a way that it is not
likely to be mistaken forthe other product.Maximum
penalty—20 penalty units.Division 6Records and
prepackagingSubdivision 1Meat and meat
products for humanand animal consumption128Records to be kept about animals killed for
meatAn accreditation holder who processes meat
or a meat productmust, for each animal killed from which the
meat or product isprocessed,keeprecordscontainingeachofthefollowingdetails—(a)the
day the animal is killed;(b)thenameornumberoftheaccreditationholderwhokilled the animal;(c)the
animal’s species;(d)iftheanimalcomesfromaplaceofproduction—theaddress of the
place;(e)if the animal is a wild animal—(i)the place where the animal was
captured; andPage 86Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
129](ii)if the animal is
killed in the wild—the place wherethe animal is
killed.Subdivision 2Meat and
ready-to-eat meat forhuman consumption129Records to be kept about meat and
ready-to-eat meat(1)An accreditation holder who processes
meat or ready-to-eatmeatforhumanconsumptionmust,forthemeatorready-to-eatmeat,keeprecordscontainingeachofthefollowing
details—(a)thenameornumberofanaccreditationholderfromwhom the meat
comes;(b)for the batch in which the meat or
ready-to-eat meat areprocessed—(i)the
number or other identification of the batch; and(ii)the name or
number of an accreditation holder whoprocessed the
batch; and(iii)the day the
batch is processed; and(iv)thenameornumberofanyotheraccreditationholder from whom
other meat or ready-to-eat meatin the batch is
derived;(c)any other information that may be
necessary to decidewhether or not the meat or ready-to-eat meat
should berecalled;(d)thenameandaddressofthepersontowhomtheaccreditation holder sent the meat or
ready-to-eat meatafter processing;(e)the
day the person sent the meat or ready-to-eat meat.(2)However, if the person to whom the
accreditation holder sentthe meat or ready-to-eat meat after
processing is the consumerof the meat or ready-to-eat meat, the
accreditation holder isCurrent as at 1 January 2014Page
87
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
130]notrequiredtokeeparecordofthedetailsmentionedinsubsection (1)(d) or (e).130Labelling meat and ready-to-eat
meatAn accreditation holder who prepackages meat
or ready-to-eatmeatforhumanconsumptionmustensurethemeatorready-to-eat meat are labelled with the
following informationbefore or when packaging—(a)the accreditation holder’s name or
number;(b)the day the meat or ready-to-eat meat
are packaged.Maximum penalty—20 penalty units.Subdivision 3Pet meat, pet
meat products andrendered products for animalconsumption131Records to be kept about pet meat, pet meat
productsand rendered products(1)An
accreditation holder who processes pet meat, a pet meatproduct or a rendered product must, for the
meat or product,keep records containing each of the
following details—(a)forthebatchinwhichthemeatorproductisprocessed—(i)the
number or other identification of the batch; and(ii)the name or
number of an accreditation holder whoprocessed the
batch; and(iii)the day the
batch is processed; and(iv)thenameornumberofanyotheraccreditationholder from whom
other meat or a product in thebatch is
derived;Page 88Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
132](b)any other information that may be
necessary to decidewhether or not the meat or product should be
recalled;(c)thenameandaddressofthepersontowhomtheaccreditationholdersentthemeatorproductafterprocessing;(d)the
day the holder sent the meat or product.(2)However, if the person to whom the
accreditation holder sentthe meat or product after processing
is the consumer of themeatorproduct,theaccreditationholderisnotrequiredtokeep a record of the details mentioned
in subsection (1)(c) or(d).(3)In
this section—consumer,ofpetmeat,apetmeatproduct,orarenderedproduct—(a)meansthepersonwhohaspurchased,orotherwiseacquired,themeatorproductforconsumptionbytheperson’s or another person’s domestic
animal; but(b)doesnotmeanapersonwhowholesales orretailsthemeat or product.132Labelling pet meat and pet meat
products(1)Anaccreditationholderwhoprepackagespetmeatorapetmeat product
must ensure the meat or product is labelled witheach
of the following before or when packaging—(a)the
accreditation holder’s name or number;(b)the
use-by date or batch number of the meat or product;(c)the weight of the meat or
product;(d)the ingredients of the meat or
product;(e)the requirements for storage of the
meat or product;Example for paragraph (e)—a package of pet meat is labelled
‘Keep frozen’Current as at 1 January 2014Page
89
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
133](f)thestatement‘Animalfood—Notforhumanconsumption’or‘Petfood—Notforhumanconsumption’;(g)if
the meat or product is packaged for retail sale—(i)the list of ingredients; and(ii)graphics showing
the type of animal for which themeat or product
is intended.Example for subparagraph (ii)—the packaging on a pet meat product
has a drawing of adog to show the product is intended to be
consumed by adogMaximum penalty—20 penalty
units.(2)For subsection (1)(f), the statement
must be—(a)in standard type of at least 3mm in
height; and(b)inacolourcontrastingdistinctlywiththebackgroundcolour of the
label or packaging; and(c)conspicuous to a
person looking at the label.133Labelling rendered productsAnaccreditationholderwhopackagesarenderedproductmustensuretheproductislabelledwiththefollowinginformation
before or when packaging—(a)the
accreditation holder’s name or number;(b)the
day the product is packaged.Maximum
penalty—20 penalty units.Page 90Current as at 1
January 2014
Division 7Food Production
(Safety) Regulation 2002Chapter 4 Meat schemePart
2 Food safety requirements[s 133A]Additional
provisions for poultrymeatSubdivision
1Preliminary133APurpose of div 7The purpose of
this division is to give effect, generally, to thefood
standards code, standard 4.2.2 (Primary production andprocessing standard for poultry
meat).Editor’s note—ThestandardmaybeviewedonSafeFood’swebsiteat<www.safefood.qld.gov.au>.133BDefinitions for div 7In
this division—hazardmeans a
biological, chemical or physical agent in, orcondition of,
food that has the potential to cause an adversehealth effect in
humans.inputsincludesanyfeed,litter,water,chemicalsorothersubstancesusedin,orinconnectionwith,aprimaryproduction or
processing activity.poultrymeans chicken,
turkey, duck, squab (pigeons), geese,pheasants,quail,guineafowl,muttonbirdsandotheravianspecies (other than ratites).poultryhandlermeansapersonwhohandlesorsupervisesthe handling of
poultry intended for human consumption.poultry
processormeans a person accredited under the
meatschemeinthecategoryofprocessorwhocarriesoutprocessing,ortransporting,ofpoultryproductintendedforhuman consumption.Current as at 1
January 2014Page 91
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
133C]poultry producermeans a person
accredited under the meatscheme in the category of producer who
carries out rearing, orlive transporting, of poultry intended
for human consumption.poultry productmeans the
carcass of poultry, poultry meat orpoultry meat
product.processingmeans engaging
in processing activities.sewageincludesthedischargefromtoilets,urinals,basins,showers, sinks
and dishwashers, whether discharged throughsewers or other
means.133CMeaning ofunsuitablefor
poultry or poultry productPoultry or a poultry product isunsuitableif it—(a)isdamaged,deterioratedorperishedtoanextentthataffects its reasonable intended use;
or(b)containsanydamaged,deterioratedorperishedsubstance that
affects its reasonable intended use; or(c)is
the product of a diseased animal, or an animal that hasdied
other than by slaughter, and has not been declaredby
or under an Act to be safe for human consumption; or(d)contains a biological or chemical
agent, or other matteror substance, that is foreign to the
nature of the food; or(e)is in a
condition, or contains a substance, that a personwouldordinarilyregardasmakingthepoultry,afterprocessing,orpoultryproductunfitforhumanconsumption.Page 92Current as at 1 January 2014
Subdivision 2Food Production
(Safety) Regulation 2002Chapter 4 Meat schemePart
2 Food safety requirements[s 133D]Food
safetyrequirements—production ofpoultry133DApplication of sdiv 2(1)The
food safety requirements mentioned in chapter 2, part 4orchapter4,part2applyinadditiontothefoodsafetyrequirements mentioned in this
subdivision.(2)However, if there is an inconsistency
between a food safetyrequirement mentioned in this
subdivision and a food safetyrequirement
mentioned in chapter 2, part 4 or chapter 4, part2,
the food safety requirement mentioned in this subdivisionprevails to the extent of the
inconsistency.133EGeneral food safety management(1)Apoultryproducermustsystematicallyexamineallofitsprimaryproductionoperationstoidentifypotentialhazardsand implement
control measures to address those hazards.Maximum
penalty—50 penalty units.(2)A poultry
producer must have evidence to show a systematicexaminationhasbeenundertakenandcontrolmeasuresforidentified hazards have been
implemented.Maximum penalty—50 penalty units.133FInputsApoultryproducermusttakeallreasonablemeasurestoensure inputs do not make the poultry
unsuitable.Maximum penalty—50 penalty units.Current as at 1 January 2014Page
93
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
133G]133GWaste disposal(1)A
poultry producer must store, handle or dispose of waste in away
that will not make the poultry unsuitable.Maximum
penalty—50 penalty units.(2)In this
section—wasteincludes sewage,
waste water, litter, dead poultry andgarbage.133HHealth and hygiene requirements(1)A poultry handler must exercise
personal hygiene and healthpractices that
do not make the poultry unsuitable.Maximum
penalty—50 penalty units.(2)Apoultryproducermusttakeallreasonablemeasurestoensurethefollowingpersonsexercisepersonalhygieneandhealth practices that do not make the
poultry unsuitable—(a)each poultry handler involved in the
production of thepoultry;(b)eachpersonwhoworksatthepremiseswheretheproduction is taking place;(c)each visitor to the premises.Maximum penalty—50 penalty units.133ISkills and knowledgeA
poultry producer must ensure each poultry handler involvedin
the production of the poultry has appropriate—(a)skills in food safety and food hygiene;
and(b)knowledge of food safety and food
hygiene matters.Maximum penalty—50 penalty units.Page
94Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
133J]133JDesign, construction and maintenance
of premises,equipment and vehicles(1)This
section applies if a poultry producer—(a)is
producing poultry at premises; or(b)uses
equipment or a vehicle for producing poultry.(2)The
poultry producer must ensure the premises, equipment orvehicleisdesignedandconstructedsothepremises,equipment or
part of the vehicle containing the poultry—(a)minimises contamination of the poultry;
and(b)minimises the harbouring of pests;
and(c)is capable of being effectively
cleaned and sanitised.Maximum penalty—20 penalty
units.(3)A poultry producer must ensure the
premises, equipment orpart of the vehicle containing the
poultry is maintained andcleaned in a sanitary way, and
maintained in good repair, toensure the
poultry is not made unsuitable.Maximum
penalty—20 penalty units.133KTraceabilityApoultryproducermustbeabletoidentifytheimmediaterecipient of the
poultry handled by the poultry producer.Maximum
penalty—50 penalty units.133LSale or supply of
poultryA poultry producer must not sell or supply
poultry for humanconsumptioniftheproducerknows,oughtreasonablytoknow,oroughtreasonablytosuspect,thepoultryisunsuitable.Maximum
penalty—50 penalty units.Current as at 1 January 2014Page
95
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
133M]Subdivision 3Food
safetyrequirements—processing ofpoultry133MApplication of sdiv 3(1)The
food safety requirements mentioned in chapter 2, part 4orchapter4,part2applyinadditiontothefoodsafetyrequirements mentioned in this
subdivision.(2)However, if there is an inconsistency
between a food safetyrequirement mentioned in this
subdivision and a food safetyrequirement
mentioned in chapter 2, part 4 or chapter 4, part2,
the food safety requirement mentioned in this subdivisionprevails to the extent of the
inconsistency.133NGeneral food safety management(1)Apoultryprocessormustsystematicallyexamineallofitsprocessingoperationstoidentifypotentialhazardsandimplement control measures to address those
hazards.Maximum penalty—50 penalty units.(2)A poultry processor must have evidence
to show a systematicexaminationhasbeenundertakenandcontrolmeasuresforidentified hazards have been
implemented.Maximum penalty—50 penalty units.(3)Apoultryprocessormustverifytheeffectivenessofthecontrol measures.Maximum
penalty—50 penalty units.133OReceiving or
processing poultry productApoultryprocessormustnotreceiveorprocesspoultryproduct for human consumption if the
processor knows, oughtreasonablytoknow,oroughtreasonablytosuspect,thepoultry product is unsuitable.Page
96Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 2 Food safety requirements[s
133P]Maximum penalty—50 penalty units.133PInputsApoultryprocessormusttakeallreasonablemeasurestoensure inputs do not make the poultry
product unsuitable.Maximum penalty—50 penalty units.133QWaste disposal(1)A
poultry processor must store, handle or dispose of waste ina
way that will not make the poultry product unsuitable.Maximum penalty—50 penalty units.(2)In this section—wasteincludes unsuitable poultry, unsuitable
poultry product,sewage, waste water and garbage.133RSkills and knowledgeA
poultry processor must ensure each person involved in theprocessing has appropriate—(a)skills in food safety and food
hygiene; and(b)knowledge of food safety and food
hygiene matters; and(c)skillsandknowledgetodetectaconditionthatwouldrender poultry
or poultry product unsuitable.Maximum
penalty—50 penalty units.133STraceabilityA poultry
processor must ensure it can identify the immediatesupplier and immediate recipient of poultry
product handledby the poultry processor.Maximum penalty—50 penalty units.Current as at 1 January 2014Page
97
Food
Production (Safety) Regulation 2002Chapter 4 Meat
schemePart 3 Accreditation for persons from another
State[s 133T]133TSale
or supplyA poultry processor must not sell or supply
poultry productforhumanconsumptioniftheprocessorknows,oughtreasonablytoknow,oroughtreasonablytosuspect,thepoultry product is unsuitable.Maximum penalty—50 penalty units.Part
3Accreditation for persons fromanother State134When
person from another State taken to holdaccreditation(1)This
section applies to the following—(a)a
person who is not accredited in the State to kill wildanimals but is licensed to kill wild
animals;(b)a person who is not accredited in the
State to transportmeat or a meat product but is licensed to
transport meator a meat product from or to the
State.(2)For subsection (1)(a), the person is
taken to be the holder of anaccreditation to
kill animals in the wild for meat.(3)For
subsection (1)(b), the person is taken to be the holder ofan
accreditation to transport meat or a meat product.(4)If the licence held by the person is
subject to a restriction orcondition, the
accreditation the person is taken to hold is alsotaken to be subject to a restriction or
condition in the sameterms, so far as practicable, as the
restriction or condition.(5)In this
section—licensedmeanslicensed,accreditedorotherwiseauthorisedunder the law of
another State.Page 98Current as at 1
January 2014
Chapter 4AFood Production
(Safety) Regulation 2002Chapter 4A Seafood schemePart
1 Preliminary[s 134A]Seafood
schemePart 1Preliminary134APurpose of ch 4AThe main purpose
of this chapter is to give effect to the foodstandardscode,standard4.2.1(Primaryproductionandprocessingstandardforseafood),knownasthe‘NationalSeafood Standard’.Editor’s
note—The National Seafood Standard may be
viewed on Safe Food’s websiteat
<www.safefood.qld.gov.au>.Part 2Contents of seafood scheme134BSeafood scheme applies for particular
seafood(1)The seafood food safety scheme
(theseafood scheme) appliesforestuarine,freshwaterormarinefish,andotheraquaticanimals, intended for human
consumption.(2)However, the seafood scheme does not
apply to amphibians,aquatic plants, mammals or
reptiles.134CProduction of seafood for which
seafood scheme appliesTheseafoodschemeappliesfortheproductionofseafood,including, for
example, the following—(a)catching,
collecting, cultivating, growing, harvesting orpicking
seafood;(b)handling,processingortransportingseafood,atanystage, from
seafood premises to a retailer, commercialCurrent as at 1
January 2014Page 99
Food
Production (Safety) Regulation 2002Chapter 4A Seafood
schemePart 2 Contents of seafood scheme[s
134D]user of seafood or manufacturer of
seafood;(c)freezing,packing,refrigerating,storing,treatingorwashing seafood;(d)dismembering, filleting, peeling or shucking
seafood;(e)adding brine to seafood;(f)boiling crustaceans or
shellfish;(g)supplying seafood from seafood
premises.134DProduction of seafood for which
seafood scheme doesnot apply(1)Despite section 134C, the seafood scheme
does not apply forthe following—(a)manufacturing seafood;(b)taking seafood by an Aborigine or Torres
Strait Islanderunder Aboriginal tradition or Island
custom;(c)harvesting seafood for personal
consumption.Example—recreational catch(2)Also, the seafood scheme does not apply to a
business that—(a)processesseafoodatpremisesotherthanonacommercialfishingboatoratanaquaculturefacility;and(b)onlysuppliestheseafooddirectlytoapersonfortheperson’s
consumption.Example—cooking and selling seafood at a fish and
chip shop(3)In this section—manufacturing, in relation to
seafood, means dealing with theseafood under a
process, including, for example, canning theseafoodorcoatingtheseafoodwithbreadcrumbs,inwhichthe nature of
the seafood is substantially changed.Page 100Current as at 1 January 2014
Part
3Food Production (Safety) Regulation
2002Chapter 4A Seafood schemePart 3 Categories
of accreditation, programs and management statements[s
134E]Categories of accreditation,programs and managementstatements134ECategories of accreditation(1)A person may be accredited under the
seafood scheme in anyof the following categories—(a)processor;(b)producer;(c)wild
animal harvester.(2)A person accredited under the seafood
scheme in a particularcategorymay,undertheaccreditation,carryoutonlytheactivities mentioned in schedule 5B for the
category.134FRequirement for program or management
statement(1)An applicant for a grant or renewal of
an accreditation undertheseafoodschemeasaprocessormustprepareaprogramunder the
scheme.(2)An applicant for a grant or renewal of
an accreditation undertheseafoodschemeasaproducerorwildanimalharvestermust prepare a
management statement under the scheme.Current as at 1
January 2014Page 101
Food
Production (Safety) Regulation 2002Chapter 4A Seafood
schemePart 4 Food safety requirements[s
134G]Part 4Food safety
requirementsDivision 1Preliminary134GApplication of pt 4This part
applies for food safety requirements for the seafoodscheme.Division 2GeneralSubdivision
1Information requirements134HInformation about seafood business to be
given to SafeFood(1)This
section applies to a person who has the management andcontrol of a business that engages in the
production of seafoodand is, or is required to be, an
accreditation holder under theseafood
scheme.(2)Beforestartingproductionofseafood,thepersonmust,inwriting, give Safe Food the following
information about theperson’s business—(a)thecontactdetailsforthebusiness,includingitsbusiness name;(b)the
name and business address of the proprietor of thebusiness;(c)the
nature of the business;(d)the location of
all premises intended to be used by theperson for the
production of seafood.Maximum penalty—20 penalty
units.Page 102Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4A
Seafood schemePart 4 Food safety requirements[s
134I](3)Before any change happens in the
person’s business that willresult in
information given by the person to Safe Food underthis
section being incomplete or inaccurate, the person mustgive
Safe Food written notice of the change unless the personhas
a reasonable excuse.Maximum penalty—20 penalty
units.Subdivision 2Seafood
production activities134ISeafood safety
management(1)Anaccreditationholderwhoengagesintheproductionofseafood must—(a)systematicallyexaminealloftheholder’sactivitiesinrelation to the seafood—(i)toidentifypotentialfoodsafetyhazardsfortheseafood; and(ii)toimplementcontrolsthatareappropriateformanaging the food safety hazards; and(b)keep records or other evidence to
demonstrate that theholder has implemented controls that
are appropriate formanaging the food safety hazards.Maximum penalty—20 penalty units.(2)In this section—controlsmean
the following—(a)measurestocontrolhazardsfromair,baitorotherfeedstuff,fertilizers,pesticides,soil,veterinarydrugs,wateroranyotheragentusedintheproductionofseafood;(b)measures to protect any seafood from
contamination byfaeces or another substance.fertilizerincludes a
natural fertilizer.Current as at 1 January 2014Page
103
Food
Production (Safety) Regulation 2002Chapter 4A Seafood
schemePart 4 Food safety requirements[s
134J]134JContamination and handling(1)Anaccreditationholderwhoengagesintheproductionofseafood must take all necessary steps to
prevent the seafoodbecoming contaminated.Maximum
penalty—20 penalty units.(2)Anaccreditationholderwhoengagesintheproductionofseafoodatseafoodpremisesmusttakeallreasonablemeasurestoensurethatseafoodhandlersatthepremiseshandletheseafood,orsurfaceslikelytocomeintocontactwiththeseafood,inawaythatisnotlikelytoaffecttheacceptability of the seafood.Maximum penalty—20 penalty units.134KInputs and harvesting areas(1)Anaccreditationholderwhoengagesintheproductionofseafood must take all reasonable steps to
ensure inputs do notadversely affect the acceptability of
the seafood.Maximum penalty—20 penalty units.(2)An accreditation holder must not
harvest seafood in an area ifthe holder
knows, or ought reasonably to know, the seafoodmay not be
acceptable for human consumption when it is sold.Maximum penalty—20 penalty units.(3)In this section—inputsmeans any chemicals or feed or other
substances usedin, or in connection with, the production of
seafood.134LStoring seafood(1)Anaccreditationholderwhostoresseafood,otherthanliveseafood,
must—(a)store the seafood under temperature
control; and(b)have a way of monitoring the
temperature of the seafoodwhile it is stored.Page
104Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4A
Seafood schemePart 4 Food safety requirements[s
134M]Maximum penalty—20 penalty units.(2)An accreditation holder who stores
live seafood must store theseafoodinawaythatwillnotadverselyaffecttheacceptability of the seafood.Maximum penalty—20 penalty units.134MTransporting seafood(1)Anaccreditationholderwhotransportsseafood,otherthanlive
seafood, must—(a)transport the seafood under
temperature control; and(b)have a way of
monitoring the temperature of the seafoodduring the
transportation.Maximum penalty—20 penalty units.(2)Anaccreditationholderwhotransportsliveseafoodmusttransport the seafood under conditions that
will not adverselyaffect the acceptability of the
seafood.Maximum penalty—20 penalty units.134NPackaging seafoodAn accreditation
holder who packages seafood must—(a)use
only packaging material that is—(i)fit
for its intended use; and(ii)not likely to
cause contamination of the seafood;and(c)take all reasonable measures to ensure
that the seafooddoes not become contaminated during the
packaging ofthe seafood.Maximum
penalty—20 penalty units.Current as at 1 January 2014Page
105
Food
Production (Safety) Regulation 2002Chapter 4A Seafood
schemePart 4 Food safety requirements[s
134O]134OSeafood for disposal(1)Anaccreditationholderwhoengagesintheproductionofseafood must ensure that seafood for
disposal is held and keptseparate until—(a)the
seafood is destroyed, or otherwise used or disposedof,
so that it can not be used for human consumption; or(b)the seafood is returned to its
supplier; or(c)theseafoodisprocessedinawaythatensuresitisacceptable; or(d)theaccreditationholderascertainsbyvalidation,andSafe
Food agrees, that the seafood is acceptable for sale.Maximum penalty—20 penalty units.(2)Theaccreditationholdermustclearlyidentifyanyseafoodthat is held and
kept separate under subsection (1) as—(a)recalled seafood; or(b)returned seafood; or(c)seafood that is acceptable; or(d)seafood that may not be
acceptable.Maximum penalty—20 penalty units.(3)In this section—seafood for
disposalmeans—(a)seafood that is subject to a recall, has
been returned or isnot acceptable; or(b)seafood the accreditation holder reasonably
suspects isnot acceptable.134PReceipt of seafood(1)AnaccreditationholderwhoengagesintheproductionofseafoodmusttakeallreasonablestepstoensuretheholderPage 106Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Chapter 4A
Seafood schemePart 4 Food safety requirements[s
134Q]accepts only seafood that is protected from
the likelihood ofcontamination.Maximum
penalty—20 penalty units.(2)An accreditation
holder who is receiving seafood, other thanlive seafood,
must take all reasonable measures to ensure theholder accepts
only seafood that is under temperature control.Maximum
penalty—20 penalty units.(3)Anaccreditationholderwhoisreceivingliveseafoodmusttake all
reasonable measures to ensure the seafood has beentransported in a way that has not or will
not adversely affectthe acceptability of the
seafood.Maximum penalty—20 penalty units.134QSkills and knowledgeAnaccreditationholderwhoengagesintheproductionofseafood at seafood premises must ensure each
seafood handleratthepremiseshasthefollowing,appropriateforthehandler’sworkandthefoodsafetyhazardsrelevanttotheproduction of the seafood—(a)skills in food safety and food
hygiene;(b)knowledge of food safety and food
hygiene matters.Maximum penalty—20 penalty units.Division 3Health and
hygiene of persons, andpremises, vehicles and
equipment134RHealth and hygiene requirements(1)A seafood handler at seafood premises
must, in the handlingor supervision of the production of
seafood at the premises,exercise personal hygiene and health
practices that—Current as at 1 January 2014Page
107
Food
Production (Safety) Regulation 2002Chapter 4A Seafood
schemePart 4 Food safety requirements[s
134S](a)areappropriateformanagingthefoodsafetyhazardsrelevant to the
production of the seafood; and(b)do
not adversely affect the acceptability of the seafood.Maximum penalty—20 penalty units.(2)Subsection(3)appliesifaseafoodhandleratseafoodpremises knows,
or ought reasonably to know, the handler—(a)hasasymptomthatindicatesthehandlermayhaveafood-borne disease; or(b)has
a food-borne disease; or(c)is a carrier of
a food-borne disease.(3)The seafood
handler must not handle seafood at the premisesifthereisareasonablelikelihoodofcontaminationoftheseafood because of the disease.Maximum penalty—20 penalty units.(4)An accreditation holder must take all
reasonable measures toensureaseafoodhandlerattheholder’sseafoodpremisesexercisespersonalhygieneandhealthpracticesatthepremises
that—(a)areappropriateformanagingthefoodsafetyhazardsrelevant to the
production of the seafood; and(b)do
not adversely affect the acceptability of the seafood.Maximum penalty—20 penalty units.(5)In this section—food-bornediseasemeansadiseasecausedbyconsumingfood containing
bacteria, pathogens or viruses.134SSeafood premises and equipment(1)This section applies to—(a)anaccreditationholder’sseafoodpremises,includinglive seafood
premises; andPage 108Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4A
Seafood schemePart 4 Food safety requirements[s
134S](b)the equipment used in the production
of seafood at thepremises.(2)Theaccreditationholdermustensuretheseafoodpremisesandequipmentarekeptclean,sofarasisreasonablynecessary,andaredesigned,constructed,maintainedandoperated in a way that the acceptability of
seafood produced atthe premises will not be adversely
affected.Maximum penalty—20 penalty units.(3)Fortheseafoodpremisesandequipment,theaccreditationholder must
comply with—(a)the food standards code, standards
3.2.2, division 5 and3.2.3; orEditor’s
note—food standards code, standards 3.2.2
(Food safety practices andgeneralrequirements),division5(Cleaning,sanitisingandmaintenance) and 3.2.3 (Food premises
and equipment)(b)other requirements approved or imposed
by Safe Food.Examples—•requirementsinanapprovedprogramorapprovedmanagement
statement•conditions imposed on an
accreditationMaximum penalty—20 penalty units.(4)In this section—live seafood
premises—(a)means seafood
premises used for the production of liveseafood;
and(b)includes sea cages.Current as at 1 January 2014Page
109
Food
Production (Safety) Regulation 2002Chapter 4A Seafood
schemePart 4 Food safety requirements[s
134T]Division 4Records134TTracing seafoodAnaccreditationholderwhoengagesintheproductionofseafood must, to ensure the safety of the
seafood, keep recordsto identify the following—(a)any person who supplies the seafood to
the holder;(b)any person to whom the holder supplies
the seafood.Maximum penalty—20 penalty units.Division 5Bivalve
molluscs134UApplication of div 5(1)This division applies to an
accreditation holder who engagesin the
production of bivalve molluscs.(2)The
food safety requirements mentioned in division 2, 3 or 4apply to the accreditation holder in
addition to the food safetyrequirements
mentioned in this division.134VTypes of
programs(1)If the accreditation holder is a
processor, the holder’s programcomplies with
section 9 if the program—(a)isaprogramunderthefoodstandardscode,standard3.2.1; orEditor’s
note—food standards code, standard 3.2.1
(Food safety programs)(b)implements a
food safety management system under theExportControl(Dairy,EggsandFish)Orders2005(Cwlth);
orPage 110Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 4A
Seafood schemePart 4 Food safety requirements[s
134W](c)implements the hazard analysis and
critical control pointsystem (HACCP) for food safety
management, adoptedby the Codex Alimentarius Commission and set
out inthe document CAC/RCP 1-1969, Rev. 4-2003,
Annex;orEditor’s note—Acopyofthedocumentcanbeviewedat<www.codexalimentarius.net/web/index_en.jsp>.(d)is another program approved by Safe
Food.(2)In this section—hazard analysis
and critical control point system(HACCP)means a
methodology that systematically identifies, evaluatesand
controls hazards that are significant for food safety.134WAdditional food safety
requirementsThe accreditation holder must comply
with—(a)therequirementsstatedinthefoodstandardscode,standard 4.2.1, schedule; orEditor’s note—foodstandardscode,standard4.2.1(Primaryproductionandprocessingstandardforseafood),schedule(ASQAPmanualconditions)(b)other requirements Safe Food decides give
the same or ahigherlevelofprotectionformanagingexposuretorisksinrelationtofoodsafetyastherequirementsmentioned in
paragraph (a).Maximum penalty—20 penalty units.134XCo-mingling of bivalve molluscs(1)Theaccreditationholdermustensurethateachbatchofbivalve molluscs harvested is—(a)separatedfromotherbatchesofbivalvemolluscsinaway that
prevents co-mingling of batches; andCurrent as at 1
January 2014Page 111
Food
Production (Safety) Regulation 2002Chapter 5
Transitional provisionsPart 1 Transitional provision for Food
Production (Safety) Amendment Regulation (No. 2)2004[s 135](b)keptseparatefromtheotherbatchesduringanydepuration or other handling of the bivalve
molluscs inthe batch.Maximum
penalty—20 penalty units.(2)In this
section—batch, of bivalve
molluscs, means bivalve molluscs that areharvested on the
same day and from the same area.Chapter 5Transitional provisionsPart 1Transitional provision for FoodProduction (Safety)Amendment
Regulation (No. 2)2004135Application of s
87F before 1 July 2005Before 1 July 2005, section 87F
applies to a person engagedintheproductionofeggsoreggproductsonthecommencement of the section as
if—(a)theeggschemementionedinsection87Ahadcommenced; and(b)therequirementinsection87FtogiveSafeFoodinformationbeforestartingproductionofeggsoreggproductswerearequirementtogivetheinformationbefore 1 April
2005.Page 112Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Chapter 5
Transitional provisionsPart 2 Transitional provisions for
Primary Industries and Fisheries Legislation AmendmentRegulation (No. 1) 2009[s 136]Part
2Transitional provisions forPrimary Industries andFisheries
LegislationAmendment Regulation (No. 1)2009136Application of s
134H before 1 July 2009Before 1 July 2009, section 134H
applies to a person engagedintheproductionofseafoodonthecommencementofthesection as if—(a)theseafoodschemementionedinsection134Hhadcommenced; and(b)therequirementinsection134HtogiveSafeFoodinformation
before starting production of seafood werearequirementtogivetheinformationbefore1May2009.137Delayed application of fees for
accreditation underseafood scheme(1)Until 1 January 2010, no fee is payable for
an application foran accreditation by a person who must
prepare and maintain aprogram or management statement under
the seafood scheme.(2)Subsection (1) applies despite section
27.Editor’s note—section 27 (Fees for accreditation)138Application of the Act, s 79 to
seafood scheme before 1January 2010For applying
section 79 of the Act to a person engaged in theproductionofseafood,theseafoodschemeistakentocommence on 1 January 2010.Current as at 1 January 2014Page
113
Food
Production (Safety) Regulation 2002Chapter 5
Transitional provisionsPart 2 Transitional provisions for
Primary Industries and Fisheries Legislation AmendmentRegulation (No. 1) 2009[s 138]Editor’s note—section 79 of the Act (Unauthorised
production of primary produce)Page 114Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 2Schedule 2Standards for
dairy schemesection 4Part 1Compulsory standardsColumn 1RequirementColumn 2Compulsory standard1skills and knowledge forfood standards
code, standards 4.2.4Primarypersons
processing primaryproduction and processing standard for dairy
products,produce (s 32(1))clause 6Skills and knowledgeand 4.2.4APrimaryproduction and
processing standard for specific cheeses2transporting primaryproduce (s
33(5A))food standards code, standard 4.2.4Primary productionand processing
standard for dairy products, division 3Dairy collection
and transportation3transporting primaryproduce (s 33(5))food standards
code, Part 3.2Food safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,division 5Cleaning, sanitising andmaintenance4water
supply (s 34)food standards code, Part 3.2Food
safety requirements,Standard 3.2.3Food premises and
equipmentDivision 2Design and
construction of food premisesItem 4Watersupply5health and hygienerequirements (s
38)food standards code, Part 3.2Food
safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,divisions 3 and
46design, construction andmaintenance of premisesand vehicles (s
39(3))food standards code, Part 3.2Food
safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,division 5Cleaning, sanitising andmaintenance7design, construction andfood standards
code, Part 3.2Food safety requirements,maintenance of equipmentStandard
3.2.2Food safety practices and general(s
40(2))requirements,division 5Cleaning, sanitising andmaintenancePage 116Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 2Column 1RequirementColumn 2Compulsory standard8general food safetyfood standards
code, standard 4.2.4Primary productionrequirement for
productionand processing standard for dairy
products,division 2of milk at dairy
(s 59A)Dairy primary production requirements9stock food for consumptionfood
standards code, Part 1.4Contaminants andby animals to be
milked (sresidues, Standard
1.4.2Maximum residue limits61)(Australia only)10milk
supplied must be freefood standards code, Part 1.4Contaminants andof chemical
contaminantsresidues, Standard
1.4.2Maximum residue limits(s 62)(Australia only)11health and hygienerequirements (s
65)food standards code, Part 3.2Food
safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,division 4Health and hygienerequirementsItem 14Health of food handlers12design, construction andmaintenance of
dairy andequipment (s 66(3))food standards
code, Part 3.2Food safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,division 5Cleaning, sanitising andmaintenance13receiving dairy produce forfood
standards code, Part 1.4Contaminants andprocessing (s
68)residues, Standard
1.4.2Maximum residue limits(Australia
only)14general food safetyfood
standards code, standards 4.2.4Primaryrequirement for processingproduction and processing standard for dairy
products,dairy produce at depot ordivision 4Dairy
processingand 4.2.4APrimaryfactory (s 69)production and
processing standard for specific cheeses15minimum standard fordairy produce for
humanconsumption (s 71)food standards
code, Part 1.4Contaminants andresidues,
Standard 1.4.2Maximum residue limits(Australia
only),Part 1.6Microbiological
andprocessing requirements, Standard
1.6.1Microbiological limits for foodand
Part 2.5Dairyproducts16supplying dairy produce (sfood
standards code, parts 1.3 to 1.5, standard 1.6.1 and72)part 2.517testing after processing (sfood
standards code, Part 1.6Microbiological and73)processing requirements,
Standard 1.6.1Microbiological limits for foodCurrent as at 1 January 2014Page
117
Food
Production (Safety) Regulation 2002Schedule 2Column 1RequirementColumn 2Compulsory standard18general requirements forfood standards
code, Part 3.2Food safety requirements,production of goat milk (sStandard 3.2.2Food safety
practices and general77)requirements19design, construction andmaintenance of
dairy andequipment (s 78)food standards
code, Part 3.2Food safety requirements,Standard 3.2.3Food premises and
equipment20standard for testing andfood
standards code, Part 1.6Microbiological andfrequency of testing (s 80)processing requirements, Standard
1.6.1Microbiological limits for food21labelling goat milk (s 85)food
standards code, Part 1.2Labelling and otherinformation requirements, Standard
1.2.1Applicationof labelling and
other information requirementsandStandard 1.2.3Mandatory
advisory statements anddeclarationsPart 2Advisory standardsColumn 1RequirementColumn 2Advisory standard1transporting primaryproduce (s
33(1))food standards code, Part 3.2Food
safety requirements,Standards 3.2.2Food safety
practices and generalrequirementsand 3.2.3Food
premises and equipment2design,
construction andmaintenance of premisesand vehicles (s
39(2))food standards code, standard 3.2.3Food
premises andequipment3design, construction andfood standards
code, standard 3.2.3Food premises andmaintenance of
equipmentequipment(s 40(1))4temperature control forstored milk (s 64)AS 1187Page
118Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 2Column 1RequirementColumn 2Advisory standard5design, construction andguidelines issued
by Safe Food for dairy premisesmaintenance of
dairy andequipment (s 66(2))6processing requirements (sequipment stated in AS 399369(2))7storing dairy produce (s 70)food
standards code, Part 3.2Food safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,Division 3Food
handling controlsCurrent as at 1 January 2014Page
119
Food
Production (Safety) Regulation 2002Schedule 3Schedule 3Risk categories
for dairyschemesection 43Part
1Low risk1producing dairy produce at a dairy2processing butter and fat
spreads3processing pet food4transporting dairy producePart
2High risk1processing dairy produce other than butter
and fat spreads2processing and packaging unpasteurised
goat milkPage 120Current as at 1
January 2014
Schedule 3AFood Production
(Safety) Regulation 2002Schedule 3AStandards for
egg schemesection 4Part 1Compulsory standardsColumn 1RequirementColumn 2Compulsory standard1transporting primaryproduce (s
33(5))food standards code, Part 3.2Food
safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,division 5Cleaning, sanitising andmaintenance2health and hygienerequirements (s
38)(a)for an activity mentioned in section
87B(a) or (b)carried out in a physically separate
location towhere another activity mentioned in the
section iscarried out—food standards code, Part
3.2Foodsafety requirements,
Standard 3.2.2Food safetypractices and
general requirements,division 4,clause 14 and
division 5(b)for another activity—food standards
code, Part 3.2Food safety requirements, Standard
3.2.2Foodsafety practices and general
requirements3design, construction andfood
standards code, Part 3.2Food safety requirements,maintenance of equipmentStandard 3.2.3Food premises and
equipment(ss 33(4) and 40)4stock
food for consumptionfood standards code, Part 1.4Contaminants andby bird used for
eggresidues, Standard
1.4.2Maximum residue limitsproduction (ss
87H and(Australia only)87I)5pasteurising egg productsfood
standards code, Part 1.6Microbiological and(s
87M)processing requirements, Standard
1.6.2Processingrequirements
(Australia only)Current as at 1 January 2014Page
121
Food
Production (Safety) Regulation 2002Schedule 3APart
2Advisory standardsColumn 1RequirementColumn 2Advisory standardskills and
knowledge for personsfood standards code, Part 3.2Food
safety requirements,processing primary produce (sStandard 3.2.2Food safety
practices and general32)requirements, Division
2General requirements,Item 3Food
handling—skills and knowledgePage 122Current as at 1 January 2014
Schedule 3BFood Production
(Safety) Regulation 2002Schedule 3BRisk categories
for egg schemesection 43Part 1Low
risk1producing eggs2transporting eggs or egg productsPart
2High risk1processing eggs or egg products2pasteurising egg productsCurrent as at 1 January 2014Page
123
Food
Production (Safety) Regulation 2002Schedule 4Schedule 4Standards for
meat schemesection 4Part 1Compulsory standardsColumn 1RequirementColumn 2Compulsory standard1transporting primaryproduce (s
33(5))food standards code, Part 3.2Food
safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,division 5Cleaning, sanitising andmaintenance2water
supply (s 34)food standards code, Part 3.2Food
safety requirements,Standard 3.2.3Food premises and
equipmentDivision 2Design and
construction of food premisesItem 4Watersupply3health and hygienerequirements (s
38)food standards code, Part 3.2Food
safety requirements,Standard 3.2.2Food safety
practices and generalrequirements,divisions 3 and
44design, construction andfood
standards code, Part 3.2Food safety requirements,maintenance of premisesStandard 3.2.2Food safety
practices and generaland vehicles (s 39(3))requirements,division 5Cleaning, sanitising andmaintenance5design, construction andfood standards
code, Part 3.2Food safety requirements,maintenance of equipmentStandard
3.2.2Food safety practices and general(s
40(2))requirements,division 5Cleaning, sanitising andmaintenance6general food safetyfood standards
code, standards 4.2.2Primary productionrequirement for
theand processing standard for poultryand
4.2.3production of ready-to-eatProduction and processing standard for
meatmeat (s 109A)Page 124Current as at 1 January 2014
Part
2Food Production (Safety) Regulation
2002Schedule 4Advisory
standardsColumn 1RequirementColumn 2Advisory standard1skills and knowledge forfood standards
code, Part 3.2Food safety requirements,persons processingStandard
3.2.2Food safety practices and generalprimary produce (s 32)requirements, Division
2General requirements,Item 3Food
handling—skills and knowledge2transporting primaryproduce (s
33(1))(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for natural casings—AS 5011; or(d)for poultry—AS 4465; or(e)for rabbits—AS 4466; or(f)for ratite—AS 5010; or(g)for rendered products—AS 5008;
or(h)for wild animals—AS 44643waste disposal at premises(a)meat standards code; or(s
35)(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 44644design, construction and(a)meat standards code; ormanadinvteehniacnlecse(osf3p9r(e2m))ises(b)for crocodiles—AS
4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 44645design, construction and(a)meat standards code; or(msa4i0n(te1n))ance
of equipment(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 4464Current as at 1 January 2014Page
125
Food
Production (Safety) Regulation 2002Schedule 4Column 1RequirementColumn 2Advisory standard6system for rearing animals(a)meat standards code; or9at2p)lace of
production (s(b)for poultry—AS 44657system for identifyingplace
of capture of wildanimals (s 93)(a)meat
standards code; or(b)for wild animals—AS 44648identifying source ofanimal (s 94)(a)meat
standards code;or(b)for
wild animals—AS 44649animal appropriate forproducing meat (s 95)(a)meat
standards code; or(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 446410before post mortemdisposition (s
97)(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 446411handling and dressinganimal (s 98)(a)meat
standards code; or(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 446412meat from carcass (s 99)(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 4464Page
126Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 4Column 1RequirementColumn 2Advisory standard18maintaining temperatureof carcass (s
107)(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for poultry—AS 4465; or(d)for rabbits—AS 4466; or(e)for ratite—AS 5010; or(f)for wild animals—AS 446419further processing of(a)meat standards code; ormeat
and pet meat (s 108)(b)for poultry—AS 446520rendering (s 121)AS 500821packaging andprepackaging meat
andmeat products (s 125)(a)for
meat or meat products, other than renderedproducts—(i)meat standards code; or(ii)
for crocodiles—AS 4467; or(iii) for natural casings—AS 5011;
or(iv) for poultry—AS 4465; or(v)for rabbits—AS 4466; or(vi)
for ratite—AS 5010; or(vii)for wild animals—AS 4464;
or(b)for rendered products—AS 500822storing, handling andmeat
standards codedisplaying meat and meatproducts (s
126)23identifying and labellingmeat
and meat productsfor transportation (s 127)(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for natural casings—AS 5011; or(d)for poultry—AS 4465; or(e)for rabbits—AS 4466; or(f)for ratite—AS 5010; or(g)for wild animals—AS 446424records to be kept aboutmeat
standards codeanimals killed for meat (s128)Page 128Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 4Column 1RequirementColumn 2Advisory standard25records to be kept aboutmeat and
ready-to-eatmeat (s 129)(a)meat
standards code; or(b)for crocodiles—AS 4467; or(c)for natural casings—AS 5011; or(d)for poultry—AS 4465; or(e)for rabbits—AS 4466; or(f)for ratite—AS 5010; or(g)for wild animals—AS 446426labelling meat andready-to-eat meat
(s 130)(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for natural casings—AS 5011; or(d)for poultry—AS 4465; or(e)for rabbits—AS 4466; or(f)for ratite—AS 5010; or(g)for wild animals—AS 446427records to be kept aboutpet
meat, pet meatproducts and renderedproducts (s
131)(a)meat standards code; or(b)for crocodiles—AS 4467; or(c)for natural casings—AS 5011; or(d)for poultry—AS 4465; or(e)for rabbits—AS 4466; or(f)for ratite—AS 5010; or(g)for wild animals—AS 4464Current as at 1 January 2014Page
129
Food
Production (Safety) Regulation 2002Schedule 5Schedule 5Risk categories
for meatschemesection 43Part
1Low risk1killing wild animals in the field2storing field dressed animals in cold
storage3transporting field dressed animals,
meat or meat products4storing meat or
meat products in cold storage, including, forexample,
chilling meat or meat products5wholesaling or retailing meat or meat
productsPart 2Medium
risk1processing of meat or meat products,
other than ready-to-eatmeatPart 3High
risk1processing of ready-to-eat meatPage
130Current as at 1 January 2014
Schedule 5AFood Production
(Safety) Regulation 2002Schedule 5ARisk categories
for seafoodschemesection 43Part
1Low riskallactivitiescarriedoutunderanaccreditationbyawildanimalharvester,otherthanactivitiesinrelationtobivalvemolluscsPart
2Medium riskall activities
carried out under an accreditation by a producerorprocessor,otherthanactivitiesinrelationtobivalvemolluscsPart
3High riskall activities
carried out by an accreditation holder in relationto
bivalve molluscsCurrent as at 1 January 2014Page
131
Food
Production (Safety) Regulation 2002Schedule 5BSchedule 5BActivities for
seafood schemesection 134E(2)Part 1Wild
animal harvester1anyofthefollowingactivitiescarriedoutonacommercialfishing boat or
in relation to bivalve molluscs—•catching, collecting, harvesting or picking
seafood•freezing,packing,refrigerating,storing,treatingorwashing seafood•adding brine to seafood•transporting seafood•supplying seafood2otheractivitiesauthorisedundertheaccreditationholder’sapproved program or approved management
statementPart 2Producer1any of the following activities
carried out at an aquaculturefacility, on a
commercial fishing boat or in relation to bivalvemolluscs—•catching,collecting,cultivating,growing,harvestingorpicking seafood•freezing,packing,refrigerating,storing,treatingorwashing seafood•adding brine to seafood•gilling or gutting fish•filleting or cutting fish into
portionsPage 132Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Schedule
5B•boiling crustaceans•transporting seafood•supplying seafood2otheractivitiesauthorisedundertheaccreditationholder’sapproved program or approved management
statementPart 3Processor1any of the following
activities—•cuttingintoportions,dismembering,filleting,gilling,gutting, killing or skinning seafood•depuration of crustaceans or
shellfish•peeling or shucking seafood•boiling of crustaceans•adding brine to seafood•freezing,refrigerating,packing,storing,treatingorwashing seafood•transporting seafood•supplying processed seafood2otheractivitiesauthorisedundertheaccreditationholder’sapproved programCurrent as at 1
January 2014Page 133
Food
Production (Safety) Regulation 2002Schedule 6Schedule 6Dictionarysection 3Page
134acceptable, for primary
produce, means the following—(a)for
dairy produce, eggs or egg products—not unsafe;(b)formeat,andready-to-eatmeat,intendedforhumanconsumption—(i)for
poultry meat—not unsafe or not unsuitable; or(ii)otherwise—not unsafe or not
unwholesome;(c)for pet meat, a pet meat product or a
rendered productintended for animal consumption—not
unsuitable;(d)for seafood—not unsafe or not
unsuitable.acceptablelevelofrisk,forafoodsafetyhazard,meansalevel of risk as low as is reasonably
practicable.accreditations registersee section
7A(1).advisory standardsee section
4(2).animalconsumptionmeansconsumptionbyadomesticanimal.approved management statement, of
an accreditation holder,meanstheholder’smanagementstatementapprovedundersection 9B(3).approvedprogram,ofanaccreditationholder,meanstheholder’s program approved under section
48(4) of the Act.APVMAmeanstheAustralianPesticidesandVeterinaryMedicinesAuthoritycontinuedinexistenceundertheAgriculturalandVeterinaryChemicals(Administration)Act1992(Cwlth), section
6.AQISmeans Australian
Quarantine and Inspection Service.aquaculturefacilitymeanspremisesatwhichaquacultureactivitiesarecarriedoutunderanauthorityundertheFisheries Act 1994.Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 6AS
1187means AS 1187—1996 (Australian standard for
farmmilk cooling and storage systems).AS3993meansAS3993–2003(Equipmentforthepasteurizationofmilkandotherliquiddairyproducts—Continuous-flow systems)AS4464meansAS4464—1997(Australianstandardforhygienic production of game meat for
human consumption).AS4465meansAS4465—2001(Australianstandardforconstruction of premises and hygienic
production of poultrymeat for human consumption).AS4466meansAS4466—1997(Australianstandardforhygienic production of rabbit meat for
human consumption).AS4467meansAS4467—1998(Australianstandardforhygienicproductionofcrocodilemeatforhumanconsumption).AS5008meansAS5008—2001(Australianstandardforhygienic rendering of animal
products).AS5010meansAS5010—2001(Australianstandardforhygienicproductionofratite(emu/ostrich)meatforhumanconsumption).AS5011meansAS5011—2001(Australianstandardforhygienicproductionofnaturalcasingsforhumanconsumption).assistanceanimalsseetheDisabilityDiscriminationAct1992(Cwlth), section
9.bivalve molluscs—1Bivalve molluscincludes a
cockle, clam, mussel, oyster,pipi and
scallop, intended for human consumption.2The
term does not include—(a)a scallop or
pearl oyster, if the only part consumedis the adductor
muscle; or(b)ajuvenilebivalvemollusctakenforthesolepurpose of
growing on.CARsee section 51(2).Current as at 1
January 2014Page 135
Food
Production (Safety) Regulation 2002Schedule 6Page
136carcass—(a)meansthebody,oranypartofthebody,ofadeadanimalwhetherinanuncooked,partlycookedorcooked state; and(b)includesmeat,bone,hide,skin,wool,hair,feathers,hoof, horn and viscera.chemical
productsee theChemical Usage
(Agricultural andVeterinary) Control Act 1988,
schedule.commercialfishingboatmeansaboatauthorisedforthetakingoffishfortradeorcommerceunderalawoftheCommonwealth or a State.commercial usermeans a place of
business that prepares eggsor egg products
for immediate human consumption.complianceaudit,foranaccreditationholder’sprogram,meansanauditofanaccreditationholder’sprogramtoensure—(a)the
program complies with the scheme; and(b)the
holder is maintaining the program under the scheme.compulsory standardsee section
4(1).contaminate, for primary
produce—(a)means to transmit matter to the
produce that may affectthe acceptability of the produce;
and(b)includes to transmit the matter to any
surface that maycome into contact with the produce.control measuresee section
8.cracked,foraneggshell,meansitcontainscracksthatarevisible, or visible by candling.critical control pointsee section
8.critical nonconformancesee section
44(3).dairymeans premises
used for the production of milk from ananimal.dairy schemesee section
55(1).Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 6depotmeanspremisesusedforthesampling,testing,processing by
chilling only and refrigerated storage of dairyproduce for
distribution to the wholesale market.depurationmeans a process
using a controlled environment toreduce the level
of particular pathogenic organisms that maybe present in
live crustaceans or shellfish.dressing, of
an animal, means the progressive separation ofthe animal’s
body into a carcass (or parts of a carcass), offaland
inedible material.Examples of inedible material—head, hide, feathers, feet and
visceraeggmeans a bird egg.egg
processormeans a person who—(a)engages in an activity mentioned in section
87B(d), (f),(g) or (i); or(b)receives eggs from an egg producer.egg
producermeans a person who produces eggs, whether
ornot the person grades, packs, washes,
candles, oils or storesthe eggs.egg
productmeans all or part of the content of an egg
in dried,frozen or liquid form.eggproductionidentification,foraperson,meanstheperson’suniqueidentification,approvedandregisteredbySafe
Food, as an egg producer.Example of unique
identification—amark,orcode,whetherornotitincludestheeggproducer’saccreditation
numberegg schemesee section
87A.externalenvironmentalconditionincludesanodour,dust,airflow,steam,smoke(otherthansmokefromasmokingprocessformeat),condensation,wasteandahazardousmaterial.Current as at 1
January 2014Page 137
Food
Production (Safety) Regulation 2002Schedule 6Page
138factory—(a)means premises, other than a depot,
used for processingdairy produce intended for sale; but(b)doesnotincludeadairywhereunpasteurisedmilkisproduced or packaged.field dressing, of an animal,
means the partial separation ofthe animal’s
body into a carcass (or parts of a carcass) if thehide
remains on the animal.furtherprocessing,formeat,meansprocessing(otherthancooling) that
extends the shelf life of the meat.Examples—1making
ready-to-eat meat2modified atmosphere packaginggame
boxmeans premises or a vehicle used for
chilling wildgame.game box
operatormeans a person accredited under the
meatscheme to use a game box.goat
milkmeans milk of a goat.growingonmeanstheprocessoftranslocatingajuvenilebivalve mollusc
to enable it to develop before it is sold.handling,inrelationtopoultry,includestheproducing(includingrearing,harvestingorcatching),collecting,extracting,processing,manufacturing,storing,livetransporting,delivering,preparing,treating,preserving,packing,cooking,thawing,servingordisplayingofpoultryfor human
consumption.harvestingmeansthecaptureortakingofseafoodandincludes the capture or taking of seafood
from an enclosure orpond used in aquaculture.hazard, for chapter 4,
part 2, division 7, see section 133B.hazardous
materialmeans a biological, chemical or
physicalagent with the potential to cause an adverse
effect in a humanor an animal.high risksee
section 43(5).Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 6holding, for an animal,
means a run, station, feedlot, farm orplace where the
animal is fed, pastured or grazed immediatelybefore it is
killed at an abattoir.inputs, for chapter 4,
part 2, division 7, see section 133B.killing, of
an animal, includes stunning, sticking and bleeding.low
risksee section 43(3).major
nonconformancesee section 44(2).managementstatementmeansamanagementstatementprepared under a food safety scheme.manufacturermeans a person
who uses eggs or egg productsinmanufacturingaproductintendedforhumanoranimalconsumption.mealmeans a defatted and dried solid product of
renderingafter milling.meat
productmeans anything made from meat by
processingandincludesready-to-eatmeat,apetmeatproductandarendered product.meat retail
premisesmeans retail premises, or part of a
retailpremises, on or from which meat processing
is carried out, ormeat is sold, other than retail premises on
or from which allmeatsoldonthepremisesissoldreadyforimmediateconsumption.Example of part
of a retail premises—a meat section in a supermarketmeat
retail vehiclemeans a vehicle on or from which meat
issold, other than meat ready for immediate
consumption.meat schemesee section
88.meat standards codemeans the
Australian Standard for theHygienicProductionandTransportationofMeatandMeatProductsforHumanConsumptionapprovedbytheAgriculture and
Resource Management Council of Australiaand New
Zealand.medium risksee section
43(4).minor nonconformancesee section
44(1).Current as at 1 January 2014Page
139
Food
Production (Safety) Regulation 2002Schedule 6monitor—1Monitor,inrelationtocompliancewithafoodsafetyscheme,istocarryoutactivities,including,forexample, by auditing, investigating or
verification, or byoversightorsurveillanceofanaccreditationholder’sbusiness,toensuretheholderiscomplyingwiththescheme.2Initem1,verificationistheapplicationofamethod,procedure,testorothertoolforevaluationtodecidewhether a
program or management statement complieswith the food
safety scheme.nonconformance auditsee section
51(3)(c).off-farm salemeans the sale
of an egg from an egg productionfarm direct to
the public or a retailer.operational performancesee
section 8.owner, of premises,
means a person who carries on a businessof selling
primary produce from the premises.pasteurisedmeans
treated—(a)by heating to a temperature of at
least 72ºC, keeping atorabovethetemperatureforatleast15secondsandimmediatelyshockcoolingtoatemperaturebelow4.5ºC; or(b)byanyotherprocessinvolvingheatingandshockcoolingthathasanequalorgreaterlethaleffectonbacteria.petfoodmeansdairyproduceintendedforanimalconsumption.pet meatmeans meat intended for animal
consumption.petmeatproductmeansready-to-eatmeatintendedforanimal consumption.place of
production, for an animal, means the place where
theanimal has been reared before the animal
arrives at a holding.poultry, for chapter 4,
part 2, division 7, see section 133B.Page 140Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 6poultry handler, for chapter 4,
part 2, division 7, see section133B.poultry meatmeans the parts
of a poultry carcass intended forhuman
consumption.poultry processor, for chapter 4,
part 2, division 7, see section133B.poultry producer, for chapter 4,
part 2, division 7, see section133B.poultry product, for chapter 4,
part 2, division 7, see section133B.post
mortem disposition, for a carcass, means a
classificationof the parts of the carcass into the
following—(a)meat for human consumption;(b)meat for animal consumption;(c)theremainderofthecarcassthatcannotbeusedforhuman or animal consumption.preferred supplier arrangementmeans an arrangement—(a)between—(i)an
egg producer accredited under the egg schemeand an egg
processor accredited under the scheme;or(ii)a poultry
producer and a poultry processor; and(b)under which—(i)the
egg producer supplies eggs exclusively to theegg processor;
or(ii)thepoultryproducersuppliespoultryexclusivelyto the poultry
processor; and(c)approved under—(i)theeggproducer’sapprovedmanagementstatementandtheeggprocessor’sapprovedprogram; orCurrent as at 1
January 2014Page 141
Food
Production (Safety) Regulation 2002Schedule 6(ii)thepoultryproducer’sapprovedmanagementstatementandthepoultryprocessor’sapprovedprogram.prepackagedmeatmeansmeatfullyenclosedinasealedpackage that—(a)preventstheescapeofanythingthatmightbeexudedfromthemeat,includinganythingexudedifthemeatwere
to thaw; and(b)ismadeofdurablematerialandresistanttobreakageduring normal
handling; and(c)issealedsothatanyopeningandre-sealingofthepackage will be easily seen;
and(d)displays the accreditation number
under which the meatwas packaged.processing—(a)for chapter 4, part 2, division 7, see
section 133B; or(b)of seafood, includes the
following—(i)cuttingintoportions,dismembering,filleting,gilling,
gutting, killing or skinning seafood;(ii)depuration of crustaceans or
shellfish;(iii)peeling or
shucking seafood;(iv)boiling of
crustaceans;(v)adding brine to seafood;(vi)freezing,
refrigerating, packing, storing, treating orwashing
seafood.processing activityincludes
cleaning, maintaining, sanitising,killingananimal,ordoinganythingtomeatorameatproduct,including,forexample,deboning,portioning,mincing,freezing,chilling,marinating,crumbing,fullyorpartially cooking, rendering, manufacturing
and packaging.processor,underafoodsafetyscheme,meansapersonaccredited under
the scheme in the category of processor.Page 142Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 6producer,underafoodsafetyscheme,meansapersonaccredited under
the scheme in the category of producer.production, of
seafood—(a)means any of the following—(i)catching,collecting,cultivating,growing,harvesting or picking seafood;(ii)growing on of
seafood;(iii)delivering or
transporting seafood;(iv)holding live
seafood;(v)supplying seafood; and(b)includes the processing of
seafood.programsee section
9(2).ready-to-eat meatincludes—(a)smallgoods; and(b)slow-cured meat; and(c)UCFM.renderedproductmeansthemealandfatproducedbyrendering.renderingmeans the process of extracting fat from
meat byheating the meat.risk
assessmentsee section 12(2)(a).risk
categorysee section 43(1).seafood
handlermeans a person who engages in or
supervisesthe production of seafood at seafood
premises.seafood premisesmeans any
premises or vehicle at which anactivity carried
on at the premises or vehicle is the productionof
seafood.seafood schemesee section
134B(1).sewage, for chapter 4,
part 2, division 7, see section 133B.show cause
periodsee section 18(2)(h).Current as at 1
January 2014Page 143
Food
Production (Safety) Regulation 2002Schedule 6Page
144significant food safety hazard,
for primary produce, means afood safety
hazard that has the potential to make the produceunacceptable.significant food
safety mattersee section 21(1).sticking,ofananimal,meansseveringtheanimal’slargeblood vessels.stock
foodmeans a basic food, or food mixture for
feeding toan animal.stunning, of
an animal, means a procedure to make the animalunconscious and
insensible to pain.temperature control, for seafood,
means maintaining seafoodat a temperature of—(a)5ºCorbelow,ifnecessarytominimisethegrowthofinfectiousortoxicogenicmicro-organismsintheseafood to ensure the microbiological
safety of the foodwill not be adversely affected while the
food is at thetemperature; or(b)morethan5ºC,ifmaintenanceoftheseafoodatthetemperature,fortheperiodforwhichitwillbemaintained, will not adversely affect the
microbiologicalsafety of the food.transportincludesloadingprimaryproduceonto,andunloading primary produce from, a
vehicle.transportermeans—(a)fortheeggscheme—apersonaccreditedunderthescheme to transport eggs or egg
products by vehicle; or(b)forthemeatscheme—apersonaccreditedunderthescheme to transport meat or meat
products by vehicle.treatingseafood,
includes the following—(a)enhancing the
appearance of the seafood;(b)dealing with the
seafood solely to kill bacteria or germsin the
seafood.UCFMmeans a
comminuted fermented meat that has not hadits core
temperature maintained at 65ºC for at least 10 minutesCurrent as at 1 January 2014
Food
Production (Safety) Regulation 2002Schedule 6or
an equivalent combination of time and higher temperatureduring production, whether or not the meat
has been heated.unsuitablemeans—(a)for pet meat, a pet meat product or a
rendered productforanimalconsumption—themeatorproductisinacondition,orcontainsasubstance,apersonwouldordinarily regard as making the meat or
product unfit foranimal consumption; or(b)for
seafood—the seafood is in a condition, or contains asubstance, a person would ordinarily regard
as makingthe seafood unfit for human consumption;
or(c)for poultry or a poultry product—see
section 133C.unwholesome,formeatorready-to-eatmeatforhumanconsumption,meansthemeatorready-to-eatmeatareinacondition,orcontainasubstance,aconsumerwouldordinarilyregardasmakingthemeatorready-to-eatmeatunfit for human consumption.validationmeans—(a)confirmingscientificallytheeffectivenessofacontrolmeasure to
prevent or eliminate a food safety hazard—(i)at
each critical control point for the processing ofprimary produce; or(ii)atintervalsorstagesofatreatmentofprimaryproduce;
and(b)providingobjectiveevidencetoprovethecontrolmeasure is
operating within the specifications stated in aprogram or
management statement.wild animalmeans an animal,
living in a wild state and notunder artificial
confinement.wildanimalharvester,undertheseafoodscheme,meansaperson accredited under the scheme in the
category of wildanimal harvester.wildgameharvestermeansapersonaccreditedunderthemeat scheme to kill wild animals for
meat.Current as at 1 January 2014Page
145
Food
Production (Safety) Regulation 2002Schedule 6withholding periodmeans the period
between the applicationofachemicaltreatmentandwhentheresiduelevelofthechemical would
not be greater than the MRLs specified in thefoodstandardscode,Part1.4ContaminantsandResidues,Standard 1.4.2Maximum Residue
Limits.Page 146Current as at 1
January 2014
EndnotesFood Production
(Safety) Regulation 2002Endnotes1Index to endnotesPage2Date to which amendments incorporated
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.1473Key . . . . . . . . . . . . . . . . .
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . . . . . .1474Table of reprints
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . . . . . . . . . . . . .1485List
of legislation . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . . . . . . . . . . . . . . . . . . . .1496List of annotations . . . . . . . . .
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . .1512Date to which amendments
incorporatedThis is the reprint date mentioned in
theReprints Act 1992, section 5(c).
Accordingly, thisreprint includes all amendments that
commenced operation on or before 1 January 2014.Future
amendments of theFood Production (Safety) Regulation
2002may be made inaccordance with
this reprint under theReprints Act 1992, section
49.3KeyKey to
abbreviations in list of legislation and annotationsKeyAIAamdamdtchdefdivexpgazhdginslapnotfdnumo in
comorigpparaprecpresprevExplanation=Acts
Interpretation Act 1954=amended=amendment=chapter=definition=division=expires/expired=gazette=heading=inserted=lapsed=notified=numbered=order in council=omitted=original=page=paragraph=preceding=present=previousCurrent as at 1
January 2014Key(prev)procprovptpubdR[X]RArelocrenumrep(retro)rvsschsdivSIASIRSLsubunnumExplanation=previously=proclamation=provision=part=published=Reprint No. [X]=Reprints Act 1992=relocated=renumbered=repealed=retrospectively=revised version=section=schedule=subdivision=Statutory Instruments Act 1992=Statutory Instruments Regulation
2012=subordinate legislation=substituted=unnumberedPage
147
Food
Production (Safety) Regulation 2002Endnotes4Table of reprintsA new reprint of
the legislation is prepared by the Office of the Queensland
ParliamentaryCounsel each time a change to the legislation
takes effect.The notes column for this reprint gives
details of any discretionary editorial powers undertheReprints Act 1992used by the
Office of the Queensland Parliamentary Counsel inpreparing it. Section 5(c) and (d) of the Act
are not mentioned as they contain mandatoryrequirementsthatallamendmentsbeincludedandallnecessaryconsequentialamendments be
incorporated, whether of punctuation, numbering or another kind.
Furtherdetails of the use of any discretionary
editorial power noted in the table can be obtained bycontacting the Office of the Queensland
Parliamentary Counsel by telephone on 32370466 or email
legislation.queries@oqpc.qld.gov.au.From29January2013,allQueenslandreprintsaredatedandauthorisedbytheParliamentary Counsel. The previous
numbering system and distinctions between printedand
electronic reprints is not continued with the relevant details for
historical reprintsincluded in this table.ReprintNo.11A1B1C1D1E1F22A2B rv2C rv2D2E33A3B3C3D3E3F3G3HAmendments
includednone2003 SL No. 3112004 SL No.
3202004 SL No. 2182004 SL No.
3202005 SL No. 2452005 SL No.
245—2006 SL No. 2462006 SL No.
2782006 SL No. 2782007 SL No.
2322008 SL No. 4322008 SL No.
3142009 SL No. 332009 SL No.
332009 SL No. 2302009 SL No.
2302010 SL No. 2882011 SL No.
2252012 SL No. 1012012 SL No.
171Effective1 January
20035 December 200317 December
20041 January 20051 July
20057 October 20051 January
20061 January 200630 October
200617 November 20061 January
20071 January 200812 December
20081 January 200917 April
20091 July 200923 October
20091 January 20101 January
20111 January 201213 July
20121 January 2013NotesR1F
withdrawn, see R2Current as at1 January
2014Amendments included2013 SL No.
199NotesPage 148Current as at 1 January 2014
Food
Production (Safety) Regulation 2002Endnotes5List of legislationRegulatory impact statementsFor
subordinate legislation that has a regulatory impact statement,
specific reference to the statementis included in
this list.Explanatory notesAll subordinate
legislation made on or after 1 January 2011 has an explanatory
note. For subordinatelegislation made before 1 January 2011
that has an explanatory note, specific reference to the note
isincluded in this list.Food Production
(Safety) Regulation 2002 SL No. 353made by the
Governor in Council on 12 December 2002notfd gaz 13
December 2002 pp 1266–69ss 1–2 commenced on date of
notificationremaining provisions commenced 1 January
2003 (see s 2)exp 31 August 2014 (see SIA s 56A(2) and SIR
s 3 sch 2 pt 2)Notes—(1)The expiry date
may have changed since this reprint was published. Seethe
latest reprint of the SIR for any change.(2)Tworegulatoryimpactstatementsandanexplanatorynotewereprepared.amending
legislation—State Penalties Enforcement and Another
Regulation Amendment Regulation (No. 1)2003 SL No. 311
s 1 pt 2notfd gaz 5 December 2003 pp 1114–17commenced on date of notificationFood
Production (Safety) Amendment Regulation (No. 1) 2004 SL No.
218notfd gaz 15 October 2004 pp 557–8ss
1–2 commenced on date of notificationremaining
provisions commenced 1 January 2005 (see s 2)Food Production
(Safety) Amendment Regulation (No. 2) 2004 SL No. 320notfd
gaz 17 December 2004 pp 1277–85ss 1–2, 8 (to the
extent it ins new ch 3A hdg and s 87F), 9 commenced on date
ofnotification (see s 2)remaining
provisions commenced 1 July 2005 (see s 2)Note—A regulatory
impact statement and explanatory note were prepared.Food
Production (Safety) Amendment Regulation (No. 1) 2005 SL No.
245notfd gaz 7 October 2005 pp 507–9ss
1–2 commence on date of notificationpt 3 commenced 1
January 2006 (see s 2)remaining provisions commenced on date
of notificationEducation (General Provisions) Regulation
2006 SL No. 246 ss 1, 2(3), 90(1) sch 1notfd gaz 6
October 2006 pp 577–80ss 1–2 commenced on date of
notificationremaining provisions commenced 30 October
2006 (see s 2(3))Current as at 1 January 2014Page
149
Food
Production (Safety) Regulation 2002EndnotesFood
Production (Safety) Amendment Regulation (No. 1) 2006 SL No.
278notfd gaz 17 November 2006 pp 1321–2ss
1–2 commenced on date of notifications 6 commenced 1
January 2007 (see s 2)remaining provisions commenced on date
of notificationPrimary Industries Legislation Amendment
Regulation (No. 2) 2007 SL No. 232 pts1, 8notfd
gaz 21 September 2007 pp 447–9ss 1–2 commenced
on date of notificationremaining provisions commenced 1
January 2008 (see s 2(2))Primary Industries and Fisheries
Legislation Amendment Regulation (No. 1) 2008SL No. 314 pts
1, 9notfd gaz 19 September 2008 pp 407–9ss
1–2 commenced on date of notificationremaining
provisions commenced 1 January 2009 (see s 2)Food Production
(Safety) Amendment Regulation (No. 1) 2008 SL No. 432notfd
gaz 12 December 2008 pp 2044–53commenced on date
of notificationPrimary Industries and Fisheries Legislation
Amendment Regulation (No. 1) 2009SL No. 33 ss 1,
2(1), pt 7notfd gaz 17 April 2009 pp 1775–6ss
1–2 commenced on date of notificationss 46–47, 49, 52,
58 (other than to the extent it ins ch 4A hdg, s 134H), 60 (to
theextent it ins ss 137–138), 61–62, 63 (other
than to the extent it ins defproduction)commenced 1 July 2009 (see s
2(1))remaining provisions commenced on date of
notificationNote—A regulatory impact statement and
explanatory note were prepared.Food Production
(Safety) Amendment Regulation (No. 1) 2009 SL No. 230notfd
gaz 23 October 2009 pp 594–5s 5 commenced 1
January 2010 (see s 2)remaining provisions commenced on date
of notificationFood Production (Safety) Amendment Regulation
(No. 1) 2010 SL No. 288notfd gaz 15 October 2010 pp
431–2ss 1–2 commenced on date of
notificationremaining provisions commenced 1 January
2011 (see s 2)Food Production (Safety) Amendment Regulation
(No. 1) 2011 SL No. 225notfd gaz 11 November 2011 pp
495–6ss 1–2 commenced on date of
notificationremaining provisions commenced 1 January
2012 (see s 2)Food Production (Safety) Amendment Regulation
(No. 1) 2012 SL No. 101notfd gaz 13 July 2012 pp 820–5commenced on date of notificationPage
150Current as at 1 January 2014
Food
Production (Safety) Regulation 2002EndnotesFood
Production (Safety) Amendment Regulation (No. 2) 2012 SL No.
171notfd gaz 5 October 2012 pp 182–3ss
1–2 commenced on date of notificationremaining
provisions commenced 1 January 2013 (see s 2)Food Production
(Safety) Amendment Regulation (No. 1) 2013 SL No. 199notfd
<www.legislation.qld.gov.au> 11 October 2013ss
1–2 commenced on date of notificationremaining
provisions commenced 1 January 2014 (see s 2)6List
of annotationsCHAPTER 2—FOOD SAFETY SCHEMESCompulsory standard and advisory
standards 4amd 2004 SL No. 320 s 4Complying with compulsory standards
5amd 2008 SL No. 432 s 3Complying with
advisory standards 6amd 2008 SL No. 432 s 4PART
1A—ACCREDITATIONS REGISTERpt 1A (ss 7A–7D)ins 2008 SL No.
432 s 5PART 2—FOOD SAFETY PROGRAMS AND MANAGEMENT
STATEMENTSpt hdgamd 2008 SL No.
432 s 6Definitions for pt 2s 8defvalidationom 2008 SL No.
432 s 7Division 2—Preparation and maintenance of
programs and management statementsdiv hdgamd
2008 SL No. 432 s 8Preparation of programs and management
statementsprov hdgamd 2008 SL No.
432 s 9(1)s 9amd 2008 SL No. 432 s 9(2)–(3); 2009
SL No. 33 s 46Management statementss 9Ains
2008 SL No. 432 s 10Approving management statementss
9Bins 2008 SL No. 432 s 10Maintenance of
programs and management statementsprov hdgamd
2008 SL No. 432 s 11(1)s 10amd 2008 SL No.
432 s 11(2)–(3)Record keeping requirementss
16amd SL 2004 SL No. 320 s 5; 2008 SL No. 432
s 12; 2009 SL No. 33 s 47;2012 SL No. 101 s 2 schCurrent as at 1 January 2014Page
151
Food
Production (Safety) Regulation 2002EndnotesDivision 5—Amendment of programs and
management statementsdiv hdgamd 2008 SL No.
432 s 13Power to amends 17amd
2008 SL No. 432 s 14Notice of proposed amendments
18amd 2008 SL No. 432 s 15Holder’s
obligation to make decided amendments 20amd
2008 SL No. 432 s 16When holder may amends
21amd 2008 SL No. 432 s 17Deciding
applications 23amd 2008 SL No. 432 s 18Fees
for accreditation and approval as auditors 26amd
2004 SL No. 218 s 4Fees for accreditations 27amd
2012 SL No. 101 s 3; 2013 SL No. 199 s 4Exemptions from
fees for accreditations 27Ains 2005 SL No.
245 s 4amd 2006 SL No. 246 s 90(1) sch 1; 2009 SL
No. 230 s 4; 2012 SL No. 101 s4Fees
for approval as auditors 28amd 2005 SL No.
245 s 5; 2013 SL No. 199 s 5Waiver of
prescribed fee for approval as auditors 28Ains
2009 SL No. 33 s 48Payment of renewal fees 29amd
2006 SL No. 278 s 4; 2012 SL No. 101 s 5Application of pt
4s 31amd 2004 SL No. 320 s 6; 2009 SL No.
33 s 49Complying with compulsory or advisory
standards 31Ains 2008 SL No. 432 s 19Skills and knowledge for persons processing
primary produces 32amd 2008 SL No. 432 s 20Transporting primary produces
33amd 2008 SL No. 432 s 21Water
supplys 34amd 2008 SL No. 432 s 22PART
5—MONITORING COMPLIANCE WITH FOOD SAFETY SCHEMESpt
hdgsub 2008 SL No. 432 s 23Page 152Current as at 1 January 2014
Food
Production (Safety) Regulation 2002EndnotesDivision 1AA—Monitoringdiv 1AA (ss
40A–40B)ins 2008 SL No. 432 s 24Division
1—General auditing requirementdiv hdgamd
2009 SL No. 33 s 50Audits of programs 41om
2009 SL No. 33 s 51Frequency of audits for risk categorys
43amd 2004 SL No. 320 s 7; 2009 SL No. 33 s
52Audits for grant of accreditation—low
risks 45amd 2008 SL No. 432 s 25Audits for grant of accreditation—medium
risks 46amd 2008 SL No. 432 s 26Audits for grant of accreditation—high
risks 47amd 2008 SL No. 432 s 27Audits for renewal of accreditation—low
risks 48amd 2008 SL No. 432 s 28Audits for renewal of accreditation—medium
risks 49amd 2008 SL No. 432 s 29Audits for renewal of accreditation—high
risks 50amd 2008 SL No. 432 s 30Safe
Food may vary frequency of auditss 50Ains
2008 SL No. 432 s 31Identification of minor or major
nonconformances 51amd 2008 SL No. 432 s 32Identification of critical
nonconformances 52amd 2008 SL No. 432 s 33Division 5—Nonconformance with management
statementsdiv 5 (s 53)sub 2008 SL No.
432 s 34CHAPTER 3—DAIRY SCHEMEPART
1A—CATEGORIES OF ACCREDITATION AND PROGRAMSpt hdgins
2008 SL No. 432 s 35Categories of accreditations
57Ains 2008 SL No. 432 s 35Requirement for
program or management statementprov hdgins
2008 SL No. 432 s 35amd 2009 SL No. 33 s 53(1)s
57Bins 2008 SL No. 432 s 35amd 2009 SL No.
33 s 53(2)–(3)Current as at 1 January 2014Page
153
Food
Production (Safety) Regulation 2002EndnotesComplying with compulsory or advisory
standards 58Ains 2008 SL No. 432 s 36General food safety requirement for
production of milk at dairys 59Ains
2008 SL No. 432 s 37Milk supplied must be free of chemical
contaminantss 62amd 2006 SL No. 278 s 5General food safety requirement for
processing dairy produce at depot or factoryprov hdgsub
2008 SL No. 432 s 38(1)s 69amd 2008 SL No.
432 s 38(2)Division 6—Auditing requirementsdiv 6
(s 86)om 2009 SL No. 33 s 54CHAPTER 3A—EGG
SCHEMEPART 1—CONTENTS OF EGG SCHEMEpt 1
(ss 87A–87C)ins 2004 SL No. 320 s 8PART1A—CATEGORIESOFACCREDITATION,PROGRAMSANDMANAGEMENT STATEMENTSpt
hdgins 2008 SL No. 432 s 39Categories of
accreditations 87CAins 2008 SL No.
432 s 39Requirement for program or management
statements 87CBins 2008 SL No.
432 s 39amd 2009 SL No. 33 s 55PART 2—FOOD
SAFETY REQUIREMENTSpt hdgins 2004 SL No.
320 s 8Division 1—Preliminarydiv hdgins
2004 SL No. 320 s 8Application of pt 2s 87Dins
2004 SL No. 320 s 8Complying with compulsory or advisory
standards 87DAins 2008 SL No.
432 s 40Division 2—Generaldiv hdgins
2004 SL No. 320 s 8Subdivision 1—Information requirementssdiv
hdgins 2004 SL No. 320 s 8Information to be
contained in food safety program—Act, s 41(2)(f)prov
hdgins 2004 SL No. 320 s 8amd 2008 SL No.
432 s 41s 87Eins 2004 SL No. 320 s 8Page
154Current as at 1 January 2014
Food
Production (Safety) Regulation 2002EndnotesInformation about production business to be
given to Safe Foods 87Fins 2004 SL No. 320 s 8om
2008 SL No. 432 s 42Subdivision 2—Egg production
activitiessdiv hdgins 2004 SL No.
320 s 8Birds must be free of diseases
87Gins 2004 SL No. 320 s 8Stock food for
consumption by birdss 87Hins 2004 SL No.
320 s 8Eggs supplied must be free of chemical
contaminantss 87Iins 2004 SL No. 320 s 8Identifying eggs and egg productss
87Jins 2004 SL No. 320 s 8amd 2008 SL No.
432 s 43; 2009 SL No. 33 s 56Supplying
eggss 87Kins 2004 SL No. 320 s 8Supplying egg productss 87Lins
2004 SL No. 320 s 8Pasteurising egg productss 87Mins
2004 SL No. 320 s 8Division 3—Recordsdiv 3 (ss
87N–87O)ins 2004 SL No. 320 s 8Division
4—Register of egg producersdiv 4 (s
87P)ins 2004 SL No. 320 s 8om 2008 SL No.
432 s 44CHAPTER 4—MEAT SCHEMEPART 1—CONTENTS
OF MEAT SCHEMEWhat meat scheme applies fors
88sub 2012 SL No. 101 s 6Aspects of
production of primary produce to which scheme appliesprov
hdgsub 2012 SL No. 101 s 7(1)s
89amd 2008 SL No. 432 s 45; 2012 SL No. 101 ss
7(2)–(5), 2 schPART1A—CATEGORIESOFACCREDITATION,PROGRAMSMANAGEMENT STATEMENTSpt hdgins
2008 SL No. 432 s 46Categories of accreditations
89Ains 2008 SL No. 432 s 46amd 2012 SL No.
101 s 8Requirement for program or management
statements 89Bins 2008 SL No. 432 s 46ANDCurrent as at 1 January 2014Page
155
Food
Production (Safety) Regulation 2002Endnotesamd
2009 SL No. 33 s 57; 2012 SL No. 101 s 9PART 2—FOOD
SAFETY REQUIREMENTSComplying with compulsory or advisory
standards 90Ains 2008 SL No. 432 s 47Identifying source of animals
94amd 2003 SL No. 311 s 4Chilling carcass
of animal killed at abattoirs 103amd
2008 SL No. 432 s 48Chilling animal killed in the
wilds 104sub 2008 SL No. 432 s 49Receiving animal killed in the wilds
105amd 2008 SL No. 432 s 50Staining meat for
animal consumptions 106amd 2008 SL No. 432 s 51; 2012 SL No.
101 s 2 schDivision 4—Further processingFurther processing of meat and pet
meats 108amd 2012 SL No. 101 s 2 schSubdivision 2—Meat and ready-to-eat meat for
human consumptionsdiv hdgamd 2012 SL No.
101 s 2 schApplication of sdiv 2s 109amd
2012 SL No. 101 s 2 schGeneral food safety requirement for the
production of ready-to-eat meatprov hdgamd
2012 SL No. 101 s 2 schs 109Ains 2008 SL No.
432 s 52amd 2012 SL No. 101 s 2 schReceiving contaminated meat, ready-to-eat
meat and ingredientsprov hdgamd 2012 SL No.
101 s 2 schs 110amd 2012 SL No. 101 s 2 schIdentifying and separating meat not for human
consumptions 111amd 2012 SL No. 101 s 2 schIngredients used for processing meat and
ready-to-eat meatprov hdgamd 2012 SL No.
101 s 2 schs 112amd 2012 SL No. 101 s 2 schHazardous materials 113amd
2012 SL No. 101 s 2 schContamination of meat and ready-to-eat
meatprov hdgamd 2012 SL No.
101 s 2 schs 114amd 2012 SL No. 101 s 2 schPage
156Current as at 1 January 2014
Food
Production (Safety) Regulation 2002EndnotesContamination of ready-to-eat meat by
meatprov hdgamd 2012 SL No.
101 s 2 schs 115amd 2012 SL No. 101 s 2 schIdentifying and separating meat for animal
consumption and unacceptable meats 118amd
2012 SL No. 101 s 2 schDivision 6—Records and
prepackagingSubdivision 2—Meat and ready-to-eat meat for
human consumptionsdiv hdgamd 2012 SL No.
101 s 2 schRecords to be kept about meat and
ready-to-eat meatprov hdgamd 2012 SL No.
101 s 2 schs 129amd 2012 SL No. 101 s 2 schLabelling meat and ready-to-eat meatprov
hdgamd 2012 SL No. 101 s 2 schs
130amd 2012 SL No. 101 s 2 schDivision 7—Additional provisions for poultry
meatdiv hdgins 2012 SL No.
101 s 10Subdivision 1—Preliminarysdiv 1 (ss
133A–133C)ins 2012 SL No. 101 s 10Subdivision
2—Food safety requirements—production of poultrysdiv
2 (ss 133D–133L)ins 2012 SL No. 101 s 10Subdivision
3—Food safety requirements—processing of poultrysdiv
3 (ss 133M–133T)ins 2012 SL No. 101 s 10CHAPTER
4A—SEAFOOD SCHEMEch hdgins 2009 SL No.
33 s 58PART 1—PRELIMINARYpt 1 (s
134A)ins 2009 SL No. 33 s 58PART 2—CONTENTS
OF SEAFOOD SCHEMEpt hdgins 2009 SL No.
33 s 58Seafood scheme applies for particular
seafoods 134Bins 2009 SL No.
33 s 58Production of seafood for which seafood
scheme appliess 134Cins 2009 SL No.
33 s 58Production of seafood for which seafood
scheme does not apply134Dins 2009 SL No.
33 s 58amd 2012 SL No. 101 s 11PART3—CATEGORIESOFACCREDITATION,MANAGEMENT
STATEMENTSpt 3 (ss 134E–134F)ins 2009 SL No.
33 s 58PROGRAMSANDCurrent as at 1 January 2014Page
157
Food
Production (Safety) Regulation 2002EndnotesPART
4—FOOD SAFETY REQUIREMENTSpt 4 (ss 134G–134X)ins 2009 SL No.
33 s 58CHAPTER 5—TRANSITIONAL PROVISIONSch
hdgins 2004 SL No. 320 s 9sub 2009 SL No.
33 s 59PART 1—TRANSITIONAL PROVISION FOR FOOD
PRODUCTION (SAFETY)AMENDMENT REGULATION (No. 2) 2004pt
hdgins 2009 SL No. 33 s 59Application of s
87F before 1 July 2005s 135ins 2004 SL No.
320 s 9PART 2—TRANSITIONAL PROVISIONS FOR PRIMARY
INDUSTRIES ANDFISHERIES LEGISLATION AMENDMENT REGULATION
(No. 1) 2009pt 2 (ss 136–138)ins 2009 SL No.
33 s 60SCHEDULE 1—FEESsub 2004 SL No.
218 s 5amd 2004 SL No. 320 s 10; 2005 SL No. 245 s
6sub 2005 SL No. 245 s 7; 2006 SL No. 278 s
6; 2007 SL No. 232 s 16; 2008SL No. 314 s
29amd 2009 SL No. 33 s 61sub 2009 SL No.
230 s 5; 2010 SL No. 288 s 4; 2011 SL No. 225 s 4; 2012 SLNo.
171 s 4; 2013 SL No. 199 s 6SCHEDULE
2—STANDARDS FOR DAIRY SCHEMEamd 2006 SL No.
278 s 7; 2008 SL No. 432 s 53SCHEDULE
3A—STANDARDS FOR EGG SCHEMEins 2004 SL No. 320 s 11amd
2011 SL No. 225 s 5SCHEDULE 3B—RISK CATEGORIES FOR EGG
SCHEMEins 2004 SL No. 320 s 11SCHEDULE
4—STANDARDS FOR MEAT SCHEMEamd 2006 SL No. 278 s 8; 2008 SL No.
432 s 54; 2011 SL No. 225 s 6; 2012SL No. 101 s 2
schSCHEDULE 5—RISK CATEGORIES FOR MEAT
SCHEMEamd 2012 SL No. 101 s 12SCHEDULE 5A—RISK
CATEGORIES FOR SEAFOOD SCHEMEins 2009 SL No.
33 s 62SCHEDULE 5B—ACTIVITIES FOR SEAFOOD
SCHEMEins 2009 SL No. 33 s 62amd 2009 SL No.
230 s 6SCHEDULE 6—DICTIONARYdefacceptableamd 2004 SL No.
320 s 12(2); 2009 SL No. 33 s 63(3); 2012SL No. 101 s
13(3)Page 158Current as at 1
January 2014
Food
Production (Safety) Regulation 2002Endnotesdefaccreditations registerins
2008 SL No. 432 s 55(2)defapproved
management statementins 2008 SL No. 432 s 55(2)defAPVMAins 2006 SL No.
278 s 9(2)defaquaculture facilityins
2009 SL No. 33 s 63(2)defAS 3993ins
2006 SL No. 278 s 9(2)defAS 3993.1om
2006 SL No. 278 s 9(1)defbivalve
molluscsins 2009 SL No. 33 s 63(2)defcommercial fishing boatins
2009 SL No. 33 s 63(2)sub 2009 SL No. 230 s 7defcommercial userins 2004 SL No.
320 s 12(1)defcrackedins 2004 SL No.
320 s 12(1)defdepurationins 2009 SL No.
33 s 63(2)defeggins 2004 SL No.
320 s 12(1)defegg processorins 2004 SL No.
320 s 12(1)defegg producerins 2004 SL No.
320 s 12(1)defegg productins 2004 SL No.
320 s 12(1)defegg production identificationins
2004 SL No. 320 s 12(1)defegg
schemeins 2004 SL No. 320 s 12(1)deffood safety hazardom 2008 SL No.
432 s 55(1)deffood standards codeom
2008 SL No. 432 s 55(1)deffurther
processingamd 2012 SL No. 101 s 2 schdefgame boxins 2008 SL No.
432 s 55(2)defgame box operatorins 2008 SL No.
432 s 55(2)defgrowing onins 2009 SL No.
33 s 63(2)defhandlingins 2012 SL No.
101 s 13(2)defharvestingins 2009 SL No.
33 s 63(2)defhazardins 2012 SL No.
101 s 13(2)definputsins 2012 SL No.
101 s 13(2)defmanagement statementins
2008 SL No. 432 s 55(2)defmanufacturerins 2004 SL No.
320 s 12(1)defmeat productamd 2012 SL No.
101 s 2 schdefmixed retail premisesom
2009 SL No. 33 s 63(1)defmonitorins
2008 SL No. 432 s 55(2)defMRLsom
2008 SL No. 432 s 55(1)defNRAom
2006 SL No. 278 s 9(1)defoff-farm
saleins 2004 SL No. 320 s 12(1)defpet meat productamd 2012 SL No.
101 s 2 schdefpoultryins 2012 SL No.
101 s 13(2)defpoultry handlerins 2012 SL No.
101 s 13(2)defpoultry meat2012 SL No. 101 s
13(2)defpoultry processorins 2012 SL No.
101 s 13(2)defpoultry producerins 2012 SL No.
101 s 13(2)defpoultry productins 2012 SL No.
101 s 13(2)defpreferred supplier arrangementins
2004 SL No. 320 s 12(1)sub 2012 SL No. 101 s 13(1)–(2)defprocessingins 2009 SL No.
33 s 63(2)sub 2012 SL No. 101 s 13(1)–(2)defprocessing activitysub
2012 SL No. 101 s 13(1)–(2)Current as at 1
January 2014Page 159