QueenslandSupreme Court of
Queensland Act 1991RULESOFTHESUPREMECOURTVolume 1Reprinted as in
force on 5 February 1999(includes amendments up to SL No. 338
of 1998)Reprint No. 1DThis reprint is
prepared bythe Office of the Queensland Parliamentary
CounselWarning—This reprint is not an authorised
copy
Information about this reprintTheserulesarereprintedasat5February1999.Thereprintshowsthelawasamendedbyallamendmentsthatcommencedonorbeforethatday(ReprintsAct1992 s
5(c)).Thereprintincludesareferencetothelawbywhicheachamendmentwasmade—see list of legislation and list of
annotations in endnotes.Thispageisspecifictothisreprint.SeepreviousreprintsforinformationaboutearlierchangesmadeundertheReprintsAct1992.Atableofearlierreprintsisincluded in the endnotes.Also
see endnotes for information about—•when
provisions commenced•editorial changes made in earlier
reprints.
66Rules of the Supreme CourtRULES OF THE SUPREME COURT[as
amended by all amendments that commenced on or before 5 February
1999]1.The following rules may be cited as
the Rules of the Supreme Court.2.They
shall come into operation on 1 January 1901, and shall, so far
asthey are applicable, apply to proceedings in
the Court in all its jurisdictions,unless otherwise
stated, and except so far as they are inconsistent with anyprovision contained in any statute or rule of
court relating to proceedings inany special
jurisdiction of the Court.3.Theyshallalsoapply,sofarasmaybepracticable,andunlessotherwise
expressly provided, to all proceedings taken on or after 1
January1901, in all causes and matters then
pending.4.InpursuanceoftheauthorityconferredbyHerMajesty’sorderincouncil of 15 October 1894, theAdmiralty Rules 1894, shall be
varied inmanner hereinafter appearing; and the same,
as so varied, are set forth inthese rules in
their appropriate places.†ORDER
1—INTERPRETATION˙Interpretation of terms1.(1)The rules set
forth in theActs Interpretation Act 1954and
in theJudicature Act 1876, section 1
relating to the interpretation of terms, shall,except as
hereinafter stated, be applied in the construction of these
rules.(2)In the construction of these
rules—“admiralty action”meansanyaction,cause,suit,orotherproceedinginstituted in
the Court in the exercise of the jurisdiction conferred on
itby theColonial Courts
of Admiralty Act 1890.“bankruptcy”includes
“insolvency”.“books”includes any
register and any other record of information however
67Rules of the Supreme Courtcompiled, recorded or stored.“cause”includes any
subsidiary or incidental proceedings arising out of orin
the course of a cause.“Central Court”see theSupreme Court Act 1995, section
266.“central district”see theSupreme Court Act 1995, section
266A.“centralregistry”meanstheofficeoftheregistraroftheCourtatBrisbane, Rockhampton, Townsville or Cairns,
as the case may be.“district registry”meansaregistryforadistrictestablishedundertheSupreme Court Act 1995,
part 19.“Far Northern Court”see theSupreme Court Act 1995, section
266.“far northern district”see theSupreme Court Act 1995, section
266A.“Judge”means a Judge
sitting in chambers.“marshal”means the
marshal of the Court in its admiralty jurisdiction, andincludes a deputy marshal or assistant
marshal.“Master”means a Master
of the Supreme Court appointed pursuant to theSupreme Court
Act 1861, section 39A, and includes a person acting
inthe office of Master.“mentally ill
person”includes any person who has been declared by
theCourt to be mentally ill and incapable of
managing his or her estate,and any person
who is otherwise a patient as defined in theMentalHealth Act 1962, schedule 3 and
any person who, on the trial of anindictment, has
been acquitted on the ground of insanity, or who, onarraignment on an indictment, has been found
by a jury to be insane,and who in either case is still in
confinement.“Northern Court”see theSupreme Court Act 1995, section
266.“northern district”see theSupreme Court Act 1995, section
266A.“originating proceeding”means the
document by which a cause or matteris
originated.“originating summons”means and
includes every summons other than asummons in a
pending cause or matter.“party”includestheparty’ssolicitor,ifthepartysuesorappearsbyasolicitor.
68Rules of the Supreme Court“printing”includes
typewriting and lithography and reproduction of wordsbyanymechanicalmeansand“printed”hasacorrespondingmeaning.“probate action”means an action
relating to the grant or recall of probateor of letters of
administration.“proper officer”means an officer
to be ascertained as follows—(a)when
any duty to be performed under these rules is a duty whichhas
heretofore been performed by any officer—such officer shallcontinue to be the proper officer to perform
the same;(b)whenundertheserulesanynewdutyistobeperformed—theproper officer
to perform the same shall be such officer as mayfrom
time to time be directed to do so by a Judge.“receiver”includes a consignee or manager appointed by
or under an orderof the Court.“registrar”meanstheregistraroftheCourtatBrisbane,Rockhampton,TownsvilleorCairns,asthecasemaybe,andincludesadeputyregistrar; or,
where necessary, any registrar at a district registry.“ship”includes every
description of vessel used in navigation not propelledby
oars only.“surety”includes a
company authorised by law to become a surety.“taxing
officer”meansapersonappointedtodischargethedutiesofataxing officer, and includes—(a)a deputy taxing officer; and(b)in a taxing officer’s absence—a court
officer directed by the chiefjustice,
central, northern or far northern judge to discharge thetaxing officer’s duties.“these
rules”includes the forms referred to in them, and
also any rules orforms that may hereafter be made or
prescribed in amendment of oraddition to
them.“writing”includes
printing and typewriting and other similar methods ofproducing words in a visible form and“written”has a
correspondingmeaning.(3)Whenever by any statute any power or duty is
conferred or imposed
69Rules of the Supreme CourtuponanofficeroftheCourtbythenameoftheMasterinEquityorProthonotary,suchpowerordutyshallandmaybeexercisedandperformed by a Master or by the registrar
respectively.˙Currency1A.(1)In
this rule—“Commonwealth Currency Act”means theCurrency Act
1963(Cwlth)and any later
Act of the Commonwealth that provides for a decimalcurrency.“new
currency”means the currency provided for by the
CommonwealthCurrency Act.“old
currency”means the currency provided for by the Acts
repealed bythe Commonwealth Currency Act.(2)Where a reference in any of these
rules or in any of the schedules tomoneyisrelatedtoboththeoldcurrencyandthenewcurrencybytheexpression
therein of amounts respectively in the old currency and in
thenew currency, then such reference
shall—(a)untilandincludingthedaybefore14February1966—beconstruedasareferencetotheamountexpressedintheoldcurrency; and(b)onand14February1966—beconstruedasareferencetotheamount expressed in the new
currency.˙Practice incorporated in Acts by
reference abrogated andrepromulgated2.In
any case in which any power has heretofore been conferred
upon,or practice or procedure prescribed for, the
Court in any of its jurisdictionsby any statute or
rule of court by reference to any statute or rule of courttheninforce,andsuchlastmentionedstatuteorruleofcourthasbeenrepealedorabrogated,andacorrespondingornewpower,practice,orprocedure, is conferred upon the Court
or prescribed by these rules, suchcorresponding or
new power, practice, or procedure, shall be, and shall beheld
and deemed to have always been and to be, the power, practice,
orprocedure, given and prescribed by such
firstmentioned statute or rule of
70Rules of the Supreme Courtcourt, and shall hereafter be used,
exercised, and acted upon, in as full andampleamannerasifsuchcorrespondingornewpower,practice,orprocedure, had been specially mentioned
in such firstmentioned statute orrule of court, in
lieu of that actually mentioned therein.†ORDER 2—COMMENCEMENT OF CIVILPROCEEDINGS˙Mode
of commencement1.(1)Causes and
matters in the Supreme Court may be commenced bywrit
of summons, motion, petition, originating summons, or order to
showcause.(2)Causes and matters which are by any statute
or rules of court requiredor authorised to be commenced by
motion, whether on notice or ex parte, orby petition,
originating summons, or order to show cause, or in any otherspecified manner, shall and may,
respectively, be so commenced.(3)When
by any statute or rules of court any person is authorised tomake
any application to the Court or a Judge with respect to any
matterwhich is not already the subject matter of a
pending cause or matter, and noother mode of
making the application is prescribed by the statute or
rules,the application, if made to the Court, shall
be made by motion, and, if madeto a Judge, shall
be made by originating summons.(4)Except as aforesaid, and except as otherwise
provided by any statute,all causes in the Court shall be
commenced by writ of summons.(5)Causes commenced by writ of summons are
called actions.˙Titles of proceedings7.(1)Every proceeding
in the Court shall be entitled ‘In the SupremeCourt of
Queensland’.(2)If the proceeding is taken in the
Central Court , Northern Court or FarNorthern Court,
the word ‘Rockhampton’, ‘Townsville’ or ‘Cairns’ shall beadded, as the case requires.
71Rules of the Supreme Court(3)If the proceeding is taken in a
district registry, the name of the districtshall be
added.˙Writs how tested and dated8.(1)Every writ of
summons shall bear date on the day on which it isissued, and shall be tested in the name of
the Chief Justice.(2)If the office of Chief Justice is
vacant, the same shall be tested in thename of the
acting Chief Justice or if there is no acting Chief Justice in
thename of the Senior Puisne Judge resident at
Brisbane.˙Address of suitor and of suitor’s
solicitor to be endorsed onoriginating proceeding—address for
service—document exchangeaddress—name of principal and
agent9.(1)The solicitor of
a party suing by a solicitor shall endorse upon theoriginatingproceeding,anduponeverynoticeinlieuofserviceofanoriginating proceeding, the address of
the plaintiff or petitioner, and also hisor her own name
or firm and place of business and telephone number and,wherethesolicitorhasfacilitiesforthereceptionofdocumentsinadocument exchange, the document
exchange address and also, if his or herplace of business
is more than 10 km from the registry, a place to be calledhis
or her address for service, which shall not be more than 10 km from
theregistry, where any proceedings in the cause
or matter may be left for thesolicitor.(2)And, if such solicitor is only agent
of another solicitor, the solicitorshall add to the
above particulars the name or firm and place of businessand
telephone number and if applicable the document exchange address
ofthe principal solicitor.˙Party
suing in person to endorse address for service10.Apartysuinginpersonshallendorseupontheoriginatingproceeding,anduponeverynoticeinlieuofserviceofanoriginatingproceeding, the
party’s place of residence and occupation and telephonenumber(ifany)andalso,iftheparty’splaceofresidenceismorethan10kmfromtheregistry,anotherproperplacetobecalledtheparty’s
72Rules of the Supreme Courtaddress for service, which shall not be more
than 10 km from the registry,where any
proceedings in the cause or matter may be left for the
party.†ORDER 3—PARTIES TO ACTIONS†1. Generally˙Persons claiming jointly, severally, or in
the alternative may beplaintiffs1.(1)All
persons in whom any right to relief in respect of or arising
outof the same transaction or series of
transactions is alleged to exist, whetherjointly,severally,orinthealternative,maybejoinedinanactionasplaintiffs,providedthatthecaseissuchthatifsuchpersonsbroughtseparate actions
some common question of law or fact would arise.(2)However, the Court or a Judge may, in
any case in which separateand distinct questions arise, order
that separate pleadings be delivered, orseparate trials
had, or may make such other order as may be just.(3)Whenseveralplaintiffsarejoinedinanaction,judgmentmaybegiven for such 1
or more of them as is or are entitled to relief for such
reliefas he, she or they may be entitled to,
without any amendment.(4)But the
defendant shall be entitled to the defendant’s costs
occasionedby joining as a plaintiff any person who is
not entitled to relief, unless theCourt or a Judge
in disposing of the costs otherwise directs.˙Admiralty actions for wages2.In admiralty actions for sailors’ or
masters’ wages, 2 or more personsclaimingreliefagainstthesamepersonorpropertymaybejoinedasplaintiffs.
73Rules of the Supreme Court˙Action in name of wrong
plaintiff3.Whenanactionhasbeencommencedinthenameofthewrongperson as plaintiff, or it is doubtful
whether an action has been commencedin the name of
the right plaintiff, the Court or a Judge may order that anyother
person be substituted or added as plaintiff upon such terms as may
bejust.˙Counterclaim—misjoinder4.When
any person has been improperly or unnecessarily joined as aplaintiff in an action, the defendant shall
be entitled to the same relief byway of
counterclaim or set-off against the other plaintiffs or any of
them, asif such person had not been so joined,
notwithstanding such misjoinder orany proceeding
consequent thereon.˙Persons to be joined as
defendants5.(1)All persons may
be joined as defendants against whom the right toany
relief is alleged to exist, whether jointly, severally, or in the
alternative.(2)Andjudgmentmaybegivenagainstsuch1ormoreofthedefendantsasmaybefoundtobeliable,accordingtotheirrespectiveliabilities,
without any amendment.˙Joinder of parties
by leave5A.Notwithstanding rules 1 and 5, but
without prejudice to any of thepowers of the
Court or a Judge under this order, 2 or more persons may bejoined together in 1 action as plaintiffs or
as defendants with the leave of theCourt or a
Judge.˙Defendant need not be interested in all
the relief claimed6.It shall not be necessary that every
defendant shall be interested as toall the relief
claimed in the action, or as to every cause of action included
inthe action; but the Court or a Judge may make
such order as may be just toprevent any
defendant from being embarrassed or put to expense by beingrequired to attend any proceedings in which
the defendant has no interest.
74Rules of the Supreme Court˙Joinder of person severally or jointly
and severally liable7.The plaintiff may, at the plaintiff’s
option, join as parties to the sameaction all or any
of the persons severally, or jointly and severally, liable
onany 1 contract, including parties to bills of
exchange and promissory notes.˙Plaintiff in doubt as to person from whom
redress is to be sought8.When a plaintiff
is in doubt as to the person from whom the plaintiffis
entitled to relief, the plaintiff may join 2 or more persons as
defendants,to the intent that the questions as to which
(if any) of the defendants isliable, and as to
what relief the plaintiff is entitled to, may be determined
asbetween all parties.˙Trustees, executors etc. may sue and be sued
as representing estate9.(1)Trustees,
executors, and administrators may sue and be sued onbehalf of or as representing the property or
estate of which they are trusteesor
representatives, without joining any of the persons beneficially
interestedin the trust or estate, and shall be
considered as representing such persons;but the Court or
a Judge may, at any stage of the proceedings, order any ofsuchpersonstobemadeparties,eitherinadditiontoorinlieuofthepreviously
existing parties.(2)This rule applies to trustees,
executors, and administrators, sued inproceedings to
enforce a security by foreclosure or otherwise, as well as
inother cases.˙Numerous persons10.When
there are numerous persons having the same interest in thesubject matter of a cause or matter, 1 or
more of such persons may sue, andthe Court or a
Judge may authorise 1 or more of such persons to be sued,or
may direct that 1 or more of such persons shall defend, in such
cause ormatter, on behalf or for the benefit of all
persons so interested.
75Rules of the Supreme Court˙Misjoinder and nonjoinder—striking out
and addingparties—consent of plaintiff or next
friend11.(1)TheCourtshallnotrefusetodetermineacauseormatterbyreason only of the misjoinder or nonjoinder
of parties, and the Court may inevery cause or
matter deal with the matter in controversy so far as regardsthe
rights and interests of the parties actually before it.(2)The Court or a Judge may, at any stage
of the proceedings, eitherupon or without the application of
either party, and on such terms as mayappear to the
Court or Judge to be just, order that the names of any
personsimproperly joined, whether as plaintiffs or
as defendants, be struck out, orthat the names of
any persons who ought to have been joined, or whosepresence before the Court may be necessary in
order to enable the Courteffectually and completely to
adjudicate upon and settle all the questionsinvolved in the
cause or matter, be added, either as plaintiffs or
defendants.(3)Butnopersonshallbeaddedasaplaintiffsuingwithoutanextfriend, or as the
next friend of a plaintiff under any disability, without theperson’s own consent in writing
thereto.˙Application to strike out12.Anapplicationtoaddorstrikeoutorsubstituteaplaintiffordefendant may be made to the Court or a
Judge, at any time before thehearing of the
cause, or may be made at the hearing in a summary manner.˙When defendant added13.(1)Whenadefendantisaddedorsubstituted,thedefendantshall,unlessthedefendantwaivessuchservice,beservedwiththeamendedoriginating
proceedings, or with notice in lieu of service, as the case may
be,andtheproceedingsasagainstthedefendantshall,unlessotherwiseordered, be deemed to have begun only on such
service being effected.(2)Such service
shall, unless otherwise ordered by the Court or a Judge,be
effected in the same manner in which original defendants are
served.
76Rules of the Supreme Court†2. Persons under disability˙Actions by and against infants and
married women14.(1)An infant may
sue or carry on the proceedings in any cause ormatter by the
infant’s next friend, and may appear in any cause or matter
bythe infant’s guardianad litem.(2)MarriedwomenmaysueanddefendasprovidedbytheMarriedWomen’s Property
Act 1890.˙Mentally ill
persons15.A person declared to be mentally ill
may sue or defend or intervenein any cause or
matter by the committee of his or her person or estate, as
thecase may be.˙Mentally ill persons without
committees16.A person who is mentally ill but has
not been so declared, and aperson so
declared, but of whom a committee of his or her person or
estate,as the case may be, has not been appointed,
may sue by the person’s nextfriend, and may
defend or intervene by a guardian appointed by a Judge forthat
purpose.˙Next friend17.(1)Before the name of any person is used in any
cause or matter asnext friend of any infant or other party,
such person shall sign a writtenauthority to the
solicitor for that purpose, and the authority shall be filed
inthe registry with the originating
proceeding.(2)Theauthorityshallnotextendtoanyotherproceedingthanthatspecified in
it.(3)A corporation other than the Public
Trustee cannot be a next friend ora guardian for
the purpose of bringing or defending an action.
77Rules of the Supreme Court˙Adoption of actions commenced without
next friend17A.(1)If any cause or
matter is commenced without a next friend by aninfant or by a
mentally ill person who has not been so declared or by amentally ill person so declared, but of whose
person or estate, as the casemay be, a
committee has not been appointed, any person may by writtenauthority to the solicitor for that purpose,
which authority shall be filed inthe registry,
adopt the proceedings on behalf of the plaintiff and agree to
beappointed as next friend of the plaintiff in
the cause or matter.(2)Thereupon the name of such next friend
shall be added to the title ofthe cause or
matter and all previous proceedings in the cause or matter
shallbe as valid and effective for all purposes as
though they had been institutedin his or her
name as next friend of the plaintiff.˙Removal and appointment of next friend and
guardian ad litem18.(1)The Court or a
Judge may, for sufficient cause shown, remove anext friend or
guardianad litem.(2)Whenever for any reason there is no
next friend or guardianad litemofaninfant,theCourtoraJudgemayappointafitperson,withtheperson’s own consent, to be such next
friend or guardian.˙Consent of persons under disability to
procedure19.In any cause or matter to which any
infant or mentally ill person,whether so
declared or not, or a person under any other disability, is a
party,any consent as to the mode of taking evidence
or as to any other procedureshall, if given
with the sanction of the Court or Judge by the next friend,guardian, committee, or other person acting
on behalf of the person underdisability, have
the same force and effect as if such party were under nodisability and had given such consent.†3. Administration and execution of
trusts˙Next of kin or class20.(1)In any case in
which the right of the next of kin of any person or
78Rules of the Supreme Courtthe
right of any class of persons depends upon the construction which
theCourt or a Judge may put upon an instrument,
and it is not known or isdifficult to ascertain who are such
next of kin or class, and the Court orJudge considers
that in order to save expense or for some other reason itwill
be convenient to have the questions of construction determined
beforesuchnextofkinorclasshavebeenascertainedbymeansofinquiryorotherwise,theCourtorJudgemayappointsome1ormorepersonstorepresent such next of kin or class, and the
judgment or order of the Courtor Judge given or
made in the presence of the persons so appointed shall bebinding upon the next of kin or class so
represented.(2)In any other case in which any next of
kin or class are interested inany proceedings,
the Court or a Judge may, if, having regard to the natureandextentoftheinterestofsuchpersonsoranyofthem,itappearsexpedient on
account of the difficulty of ascertaining such persons, or
inorder to save expense, appoint 1 or more
persons to represent all or any ofsuch next of kin
or class, and the judgment or order of the Court or Judgegiven
or made in the presence of the persons so appointed shall be
bindingupon the persons so represented.˙Residuary legatee and next of
kin21.Any person entitled to claim
administration of the personal estate of adeceased person
as residuary legatee or next of kin, may sue for and obtainsuchrelief,oranyotherreliefthatmightbeobtainedinanactionforadministration of the estate, without joining
any other residuary legatee ornext of kin as a
party to the action.˙Person interested
in proceeds of realty22.Any person who
is entitled to claim administration of the real estateof a
deceased person as a legatee interested in a legacy charged upon
realestate, or as a person interested in the
proceeds of real estate, or as next ofkin, may sue for
and obtain such relief, or any other relief that might beobtained in an action for administration of
the estate, without joining anyother legatee or
person interested in the proceeds of the estate or next of
kinas a party to the action.
79Rules of the Supreme Court˙Residuary devisee or heir23.Any person entitled to the like relief
as residuary devisee or heir maysue for and
obtain the same, or any other relief that might be obtained in
anaction for administration of the estate,
without joining any other residuarydevisee or
co-heir as a party to the action.˙Beneficiaries24.Any
one of several beneficiaries under any deed or instrument,
whois entitled to claim the execution of the
trusts of the deed or instrument, maysue for and
obtain such relief, or any other relief that might be obtained
inanactionfortheexecutionofthetrusts,withoutjoininganyotherbeneficiary as a
party to the action.˙Waste25.In all cases of actions for the
prevention of waste, or otherwise fortheprotectionofproperty,onepersonmaysueonbehalfofhimselforherself and all persons having the same
interest.˙Executors, administrators, and
trustees26.Any executor, administrator, or
trustee, may bring an action againstany one of the
persons interested in the estate, or any one of the personswhose
rights or interests are sought to be affected in the action,
claiming theadministration of the estate or the execution
of the trusts, or any other reliefordeclarationofrightthatmightbeobtainedinanactionforsuchadministration or
execution, without joining any other person of the sameclass
as a party to the action, and may obtain such relief in that
action.˙Conduct of action27.In
any of the cases mentioned in rules 20 to 26 the Court or a
Judgemay require any person to be made a party to
the action or any proceedingin the action,
and may give the conduct of the action or any proceedingtherein to such person as the Court or Judge
may think fit, and may makesuch order in any
particular case as may be just for placing any party to
the
80Rules of the Supreme Courtrecordonthesamefootinginregardtocostsasotherpartieshavingacommon interest with the party in the matters
in question.˙Notice of judgment to be served on
certain persons—effect28.(1)Whenever, in any
action for the administration of the estate of adeceased person or for the execution of the
trusts of any deed or instrument,or for the
partition or sale of any land, a judgment or an order has
beenpronounced or made directing any account or
inquiry, or affecting the rightsor interests of
persons not parties to the action, all persons interested in
theestate or under the trust or in the land
shall be served with notice of thejudgment or
order; and after such notice such persons shall be bound by
theproceedings, in the same manner as if they
had originally been made partiesto the action,
and shall be at liberty to attend the proceedings under thejudgment or order.(2)Any
person so served may, within 1 month after such service,
applyto the Court or Judge to discharge, vary, or
add to the judgment or order.˙Order
for liberty to attend not necessary—appearance to be entered29.It shall not be necessary for any
person served with notice of anyjudgment or
order, to obtain an order for liberty to attend the
proceedingsunder such judgment or order, but such person
shall be at liberty to attendtheproceedingsuponenteringanappearanceinthesamemanner,andsubject to the same provisions, as a
defendant entering an appearance.˙Form
of notice of judgment30.Notice of a
judgment or order served pursuant to rule 28 shall beentitledintheaction,andshallbeintheforminschedule1,withsuchvariations as circumstances may
require.˙Memorandum of service to be entered in
registry31.Amemorandumoftheserviceuponanypersonofnoticeofthejudgment or order in any action under
rule 28 shall be entered in the registryupon due proof by
affidavit of such service.
81Rules of the Supreme Court˙Service of notice of judgment on
infants etc.32.(1)Notice of a
judgment or order to be served on an infant, or on amentally ill person who has not been so
declared, shall be served in thesame manner as a
writ of summons in an action.(2)The
Court or a Judge may require a guardianad litemto
be appointedfor any such person.˙Heir-at-law not necessary party in suit to
execute trusts33.In an action to execute the trusts of
a will it shall not be necessary tomake the
heir-at-law or Public Trustee a party, but the plaintiff shall be
atliberty to make the heir-at-law or Public
Trustee a party, if the plaintiffdesires to have
the will established against the heir-at-law or Public
Trustee.˙Where no legal personal representative,
Court may appoint ordispense with person to represent
estate34.If in any cause or matter it appears
to the Court or a Judge that anydeceased person
who was interested in the matter in question has no legalpersonal representative, the Court or Judge
may proceed in the absence ofany person
representing the estate of the deceased person, or may
appointsome person to represent the deceased
person’s estate for the purposes ofthe cause or
matter, on such notice to such persons (if any) as the Court
orJudge may think fit, either specially or
generally by public advertisement;and the order so
made, and any order consequent thereon, shall bind theestate of the deceased person in the same
manner in every respect as if aduly constituted
legal personal representative of the deceased had been aparty
to the cause or matter.˙Administration—appearance at chambers in
respect of creditor’sclaims35.(1)Inanactionfortheadministrationoftheestateofadeceasedperson, no party
other than the executor or administrator shall, unless byleave
of the Court or a Judge, be entitled to appear either in court or
inchambers on the claim of any person not a
party to the action against theestate of the
deceased person in respect of any debt or liability.
82Rules of the Supreme Court(2)The Court or a Judge may direct or
give liberty to any other party tothe action to
appear, either in addition to or in the place of the executor
oradministrator,uponsuchtermsastocostsorotherwiseastheCourtorJudge
shall think fit.†4. Actions by Attorney-General on
relation of private persons˙Relator36.Beforethenameofanypersonisusedasarelatorinacauseormatter, such person shall sign a written
authority to the solicitor for thatpurpose,andtheauthorityshallbefiledintheregistrywiththewritofsummons.˙Authority of Attorney-General37.The writ of summons when presented for
issue shall have upon it afiat under the hand of the
Attorney-General directing its issue.†ORDER 4—JOINDER OF CAUSES OFACTION—PARTIAL RELIEF†1.
Joinder of causes of action˙All
causes of action may be joined1.Subject to the following rules of this
order, a plaintiff may unite in thesame action
several causes of action.˙Claims by
trustee3.Claims by a trustee in bankruptcy as
such shall not, unless by leave ofthe Court or a
Judge, be joined with any claim by the trustee in any othercapacity.
83Rules of the Supreme Court˙Husband and wife4.Claims by or against husband and wife may be
joined with claims byor against either of them
separately.˙Executors and administrators5.Claimsbyoragainstanexecutororadministratorassuchmaybejoined with claims by or against him or
her personally—(a)if the lastmentioned claims are
alleged to arise with reference tothe estate in
respect of which the plaintiff or defendant sues or issued
as executor or administrator; or(b)with
the leave of the Court or a Judge.˙Claims
by joint plaintiffs6.Claims by plaintiffs jointly may be
joined with claims by them or anyof them
separately against the same defendant.˙Claims
for wrongs against several defendants7.(1)Claims for damages against several
defendants for wrongs allegedto have been
committed by them severally shall not be joined in the sameaction, nor shall a claim for damages against
several defendants for a wrongalleged to have
been committed by them jointly be joined with a claim fordamages for a wrong alleged to have been
committed by some or 1 of themonly.(2)But this rule shall not prevent
judgment from being given against any1 or more of
several defendants alleged to have jointly committed a
wrong.˙Remedy for misjoinder9.Whentheplaintiffhasunitedinthesameactionseveralcausesofaction,anydefendantwhoallegesthattheycannotallbeconvenientlydisposed of
together may at any time apply to the Court or a Judge for
anorderlimitingtheactiontosuchofthecausesofactionasmaybeconveniently
disposed of together.
84Rules of the Supreme Court˙Order for exclusion10.If,
on the hearing of an application under rule 9, it appears to
theCourt or Judge that the causes of action are
such that they cannot all beconveniently
disposed of together, the Court or Judge may order any ofsuchcausesofactiontobeexcluded,andmayorderanyconsequentialamendments to be
made, or may order separate trials of any of such causesof
action to be had, or may make such other order as may be necessary
orexpedient for the separate disposal thereof,
and may make such order as tocosts as may be
just.†2. Partial relief˙Declaratory judgments and orders11.Noactionorotherproceedingshallbeopentoobjectionontheground that a merely declaratory
judgment or order is sought thereby; andtheCourtmaymakebindingdeclarationsofrightwhetherornotanyconsequential relief is or could be
claimed.˙Actions relating to express trusts or
the administration of the estate ofa deceased
person12.The executors or administrators of a
deceased person or any of them,or the trustees
under any deed or instrument, or any of them, or any personclaimingtobeinterestedascreditor,devisee,legatee,nextofkin,orheir-at-law of a deceased person, or as a
beneficiary under the trusts of anydeed or
instrument, or claiming by assignment or otherwise under any
suchcreditor or other person as aforesaid, may
bring an action claiming relief,withoutanadministrationoftheestateortrust,inrespectofanyofthefollowing questions or matters—(a)the decision of any question affecting
the rights or interests of thepersonclaimingtobecreditor,devisee,legatee,nextofkin,heir-at-law, or
beneficiary;(b)theascertainmentofanyclassofcreditors,devisees,legatees,next of kin,
beneficiaries, or other persons;(c)thefurnishingofanyparticularaccountsbyexecutorsor
85Rules of the Supreme Courtadministrators, or trustees, and the
vouching, when necessary, ofsuch
accounts;(d)the payment or bringing into court of
any money or securities inthe hands of executors or
administrators or trustees;(e)adirectiontoexecutorsoradministratorsortrusteestodoorabstain from
doing any particular act in their character as suchexecutors or administrators or
trustees;(f)theapprovalofanysale,purchase,compromise,orothertransaction;(g)any
question arising in the administration of the estate or
trust.˙Interference with discretion of trustee
etc.13.When an action is brought by or
against an executor or administratorortrusteeundertheprovisionsofrule12claiminglimitedrelief,thebringingofsuchactionshallnotinterferewithorcontrolanypowerordiscretion vested in any executor,
administrator, or trustee, except so far assuch interference
or control may necessarily be involved in the particularrelief sought.˙Judge
not bound to order administration14.It
shall not be obligatory on the Court to pronounce a judgment
forthe administration of any trust or of the
estate of any deceased person, if thequestionsbetweenthepartiescanbeproperlydeterminedwithoutsuchjudgment.˙Orders which may be made on application
for judgment foradministration or execution of trusts, when
no accounts or insufficientaccounts have been rendered15.(1)In an action for
administration or execution of trusts by a creditoror
beneficiary under a will, intestacy, or deed of trust, when no
accounts orno sufficient accounts have been rendered,
the Court may order that the trialormotionforjudgmentshallstandoverforacertaintime,andthattheexecutors, administrators, or trustees shall
in the meantime render to theapplicant a
proper statement of their accounts, and may reserve the costs
of
86Rules of the Supreme Courtthe
proceedings.(2)Or the Court may, when necessary to
prevent proceedings by othercreditorsorbypersonsbeneficiallyinterested,pronouncetheusualjudgment for
administration, and direct that no proceedings shall be
takenunder such judgment without leave of the
Judge.˙Actions for determination of questions
of construction16.Any person claiming to be interested
under a deed, will, or otherwritten
instrument, may bring an action claiming the determination of
anyquestion of construction arising under the
instrument, and a declaration ofthe rights of the
persons interested, without any further relief.†ORDER 5—WRITS OF SUMMONS˙Action
to be commenced by writ1.Every action
shall be commenced by a writ of summons, which shallbe
endorsed with a statement of the nature of the claim made, or of
the reliefor remedy sought in the action.˙Admiralty actions2.Admiralty actions shall be of 2 kinds,
actions in rem and actions inpersonam.˙Crown admiralty actions3.Actions for condemnation of any ship,
boat, cargo, proceeds, slaves,or effects, or
for recovery of any pecuniary forfeiture or penalty, shall
beinstituted in the name of the Queen.˙Title of actions4.The
title of actions shall be as set forth in schedule 1.
87Rules of the Supreme Court˙Form of writ5.Writsofsummonsforthecommencementofanactionshallbeinsuchoneoftheformsinschedule1asmaybeapplicable,withsuchvariations as
circumstances may require.˙Cost of prolix
writs6.Anycostsoccasionedbytheuseofanyformsofwrits,andofendorsementsthereon,otherormoreprolixthantheformsherebyprescribed, shall be borne by the party using
the same, unless the Court or aJudge otherwise
orders.˙Writ for service out of the
jurisdiction7.Save as is provided in order 11, a
writ of summons to be served out ofthe jurisdiction
or of which notice is to be given out of the jurisdiction
maybe issued without leave.˙Form
of notice of writ to be given out of the jurisdiction8.Notice of a writ to be given out of
the jurisdiction shall be in the formin schedule 1
with such variations as circumstances may require.˙Time for appearance to be limited by
writ9.The time to be limited in the writ of
summons for the appearance ofanydefendantshallbenotlessthanthetimenexthereinafterspecified,according to the
place of service, that is to say—(a)where the place of service is in Queensland,
and not more than320kmfromtheplacewheretheappearanceistobeentered—8
days;(b)wheretheplaceofserviceisinQueensland,andmorethan320kmfromtheplacewheretheappearanceistobeentered—14
days;(c)if the place of service is outside
Australia (including the externalterritories)—42
days.
88Rules of the Supreme Court˙Causes removed from inferior courts or
district registries10.When a cause is removed into the
Supreme Court from an inferiorcourt, or into
the central registry from a district registry, the defendant
shall,unless the defendant has appeared in a
district registry or unless otherwiseordered,havethesametimetoappearintheSupremeCourtorcentralregistry, after
service of the order of removal, as in the case of service of
awrit of summons.†ORDER 6—ENDORSEMENTS ON WRIT OFSUMMONS˙Endorsements to be made before issue1.An endorsement of the plaintiff’s
claims shall be made on every writof summons before
it is issued.˙Amendment allowed2.(1)The
endorsement required by rule 1 shall not be invalid by
reasonof failure to set forth the precise ground of
complaint, or the precise remedyor relief to
which the plaintiff considers himself or herself entitled.(2)TheplaintiffmaybyleaveoftheCourtoraJudgeamendsuchendorsement so as to extend it to any other
cause of action or any additionalremedy or
relief.˙Probate actions3.In
probate actions the endorsement shall show whether the
plaintiffclaimsascreditor,executor,administrator,devisee,residuarylegatee,legatee, next of kin, heir-at-law, or in any
and what other character.˙Forms of
endorsement5.The endorsement of claim shall be to
the effect of such of the forms inschedule 1 as may
be applicable to the case, or, if none be found
applicable,
89Rules of the Supreme Courttheninsuchothersimilarlyconciseformasthenatureofthecasemayrequire.˙Endorsement to show representative
capacity6.If the plaintiff sues, or the
defendant or any of the defendants is sued,inarepresentativecapacity,theendorsementshallshow,inmannerappearing by such
of the forms in schedule 1 as is applicable to the case, orby
any other statement to the like effect, in what capacity the
plaintiff ordefendant sues or is sued.˙Special endorsement of certain
claims7.In any action in which the plaintiff
seeks to recover—(a)a debt or liquidated demand in money
payable by the defendant,with or without interest whether that
interest is claimed under theprovisions of
theCommon Law Practice Act 1867or
otherwise;or(b)possession of
any land (including any chattel real) with or withouta
claim for rent or mesne profits; or(c)possession of any goods with or without a
claim for hire thereof,or damages for their detention;thewritofsummonsmaybespeciallyendorsedwithparticularsofthenatureoftheplaintiff’sclaimandoftheamount(ifany)soughttoberecovered.˙Further endorsement in case of certain
claims8.(1)When the
plaintiff’s claim is for a debt or liquidated demand only,with
or without interest, the endorsement, besides stating the nature of
theclaim, shall state the amount claimed in
respect of the debt or demand andinterest, and for
costs on issuing the writ, respectively, and that if paymentof
the amounts so claimed be made within the time allowed for
appearancefurther proceedings will be stayed.(1A)The endorsement
shall also state the additional amount claimed forcosts
of judgment in default of appearance and that if payment of the
whole
90Rules of the Supreme Courtoftheamountssoclaimed,includingsuchadditionalamount,bemadebefore execution
is issued, further proceedings will be stayed.(1B)Such
statement shall be in the form of schedule 1 if the
defendantmakesortenderspaymentonaccountofsuchdebtordemandwithorwithout interest and the costs of
issuing the writ then unless the plaintiffrecovers on such
account a greater sum the costs incurred after the date ofsuch
payment or tender shall unless the Court or a Judge otherwise
ordersbe paid by the plaintiff.(2)When
the plaintiff’s claim is for possession of any land
(includingany chattel real), with or without a claim
for rent or mesne profits, or forpossessionofanygoods,withorwithoutaclaimforhirethereofordamages for their detention, the
endorsement, besides stating the nature ofthe claim, may
state the amount (if any) claimed for rent, mesne profits,hireordamagesfordetention,andforcostsonissuingthewrit,respectively, and
that if possession of the land or goods be delivered, andpayment of the amounts so claimed be made,
within the time allowed forappearance
further proceedings will be stayed.(2A)The
endorsement may also state the additional amounts claimed
forcosts of judgment in default of appearance
and that if possession of the landorgoodsbedelivered,andpaymentofthewholeoftheamountssoclaimed,includingsuchadditionalamount,bemadebeforeexecutionisissued, further proceedings will be
stayed.(2B)Such statement
shall be in the form of schedule 1.(3)Iftheamountclaimedforcostsonissuingthewritofsummonsexceeds the sum
prescribed in schedule 2, part 16 and the defendant withinthe
time allowed for appearance pays the amounts claimed in respect of
thedebt or demand and for such costs, or
delivers possession of the land orgoodsandpaystheamountsclaimedforrent,mesneprofits,hireordamages for detention and for such
costs, as the case may be, the defendantmay
notwithstanding such payment, have the costs taxed, and if more
than1/6thereof be disallowed or not more than the
sum prescribed in schedule 2,part 16 be
allowed the plaintiff’s solicitor shall pay the costs of taxation
andshall repay to the defendant the difference
between the amount claimed forcosts and the
amount allowed on taxation.(4)If the amount
claimed for costs on issuing the writ of summons doesnotexceedthesumprescribedinschedule2,part16andtheamount
91Rules of the Supreme Courtclaimed for costs of obtaining judgment in
default of appearance does notexceed the sum
prescribed in schedule 2, part 16, and the defendant doesnot
appear, such costs shall not be subject to taxation.(5)Iftheamountclaimedforcostsonissuingthewritofsummonsexceeds the sum
prescribed in schedule 2, part 16 or the amount claimed forcostsofobtainingjudgmentindefaultofappearanceexceedsthesumprescribed in
schedule 2, part 16, and the defendant does not appear, theplaintiff’s solicitors before obtaining
judgment in default of appearance shallfile, for
submission to the registrar, a memorandum of the details of
thecosts so claimed on issuing the writ and of
obtaining judgment in default ofappearance.(6)The
registrar shall determine the amount of costs to be allowed
andshallendorsehisorherdeterminationonthememorandumfiledbytheplaintiff’s
solicitor.(7)The amount for costs to be specified
in the judgment in default ofappearance shall
be the amount so determined by the registrar.(8)Iftheregistrardisallowsmorethan1/6ofeitheroftheamountsclaimed for costs
on issuing the writ or of judgment or does not allow morethan
the total of the sums prescribed in schedule 2, part 16 for costs
onissuing a writ of summons and for costs of
obtaining judgment in default ofappearanceinallforcoststheplaintiff’ssolicitorshallpaythecostsoftaxation but otherwise no costs of taxation
shall be payable.˙Ordinary account9.In
an action in which the plaintiff desires to have an account taken
inthe first instance, the writ of summons may
be specially endorsed with aclaim that such
account be taken.˙Special endorsement of limited special
relief10.In an action brought under the
provisions of order 4, rule 12 or 16,thewritofsummonsmaybespeciallyendorsedwithaclaimforthespecific limited relief
sought.
92Rules of the Supreme Court˙Special endorsement in actions for
foreclosure etc.11.In an action by a mortgagee or
mortgagor, whether legal or equitable,or by any person
who has or is entitled to a legal or equitable charge uponany
property, or who has or is entitled to any property subject to a
legal orequitablecharge,orbyanypersonentitledtoforecloseorredeemanymortgage, whether legal or equitable, the
writ of summons may be speciallyendorsed with a
claim for such relief of the nature or kind following as maybe
specified in the endorsement, and as the circumstances of the case
mayrequire;thatistosay,paymentofmoneyssecuredbythemortgageorcharge; sale; foreclosure; delivery of
possession (whether before or afterforeclosure)tothemortgageeorpersonentitledtothechargebythemortgagor or
person having the property subject to the charge or by anyother
person in, or alleged to be in possession of the property;
redemption;reconveyance; delivery of possession by the
mortgagee.˙Possession after foreclosure11A.Where any
mortgage security is foreclosed by reason of the failureto
redeem by any plaintiff in a redemption action, the defendant in
whosefavour the foreclosure has taken place may
apply by motion or summons tothe Court or a
Judge for an order for delivery to the defendant of
possessionof the mortgaged property and the Court or a
Judge may make such orderthereon as the justice of the case may
require.˙Judgment in default11B.In
any action in which the plaintiff is claiming any relief of
thenature or kind specified in rule 11—(a)nojudgmentshallbeenteredindefaultofappearanceorofdefencewithouttheleaveoftheCourtoraJudgewhomayrequire the application to be
supported by such evidence as mightbe required if
judgment were being sought on motion under order19,
rule 4, and may require notice of such evidence to be given
tothe defendant and to such other person (if
any) as the Court or aJudge may think proper;(b)onanyapplicationforjudgmentunderorder31,rule11—theCourt or a Judge may require the application
to be supported by
93Rules of the Supreme Courtsuchevidenceasmightberequiredifjudgmentwerebeingsought on motion
under order 19, rule 4, and may require noticeof such evidence
to be given to the defendant and to such otherperson (if any)
as the Court or a Judge may think proper.˙Form
of special endorsement12.(1)Special
endorsements of writs shall be in the forms in schedule 1,or in
such similar form as may be applicable to the case.(2)A special endorsement may be joined
with an endorsement which isnot
special.(3)In such case the plaintiff shall
deliver a statement of claim in respectof such claims as
are not specially endorsed.˙Account in certain admiralty actions14.In admiralty actions for sailor’s or
master’s wages, or for master’swages and
disbursements, or for necessaries, or for bottomry, or any
otheradmiralty action in which the plaintiff
desires an account, the endorsementon the writ may
include a claim to have an account taken.†ORDER 7—ISSUE OF WRITS OFSUMMONS—WARRANTS IN ADMIRALTY ACTIONS†1. Issue of writs˙Preparing and printing writs1.Writs of summons shall be prepared by
the plaintiff or the plaintiff’ssolicitor, and
shall be written or printed or partly written and partly
printed,on paper of the same description as is
directed by these rules in the case ofproceedings
directed to be printed.
94Rules of the Supreme Court˙Issue2.(1)Every writ of summons shall be signed and
sealed by the properofficer, and shall thereupon be deemed
to be issued.(2)However, if any such writ shall appear
to the registrar at Brisbane,Rockhampton,TownsvilleorCairnsonitsfacetobeanabuseoftheprocess of the
Court or a frivolous or vexatious proceeding, the registrarshall
seek the direction of a Judge who may direct the registrar to issue
thesame or to refuse to issue the same without
leave of a Judge first had andobtained by the
party seeking to issue the same.˙Copy
to be left3.(1)The plaintiff,
or the plaintiff’s solicitor, shall, on presenting any writof
summons for issue, leave with the officer a copy, written or
printed, orpartly written and partly printed, on paper
of the description aforesaid, ofsuchwrit,andofalltheendorsementsthereon,andsuchcopyshallbesigned by or for the solicitor leaving the
same, or by the plaintiff personallyif the plaintiff
sues in person.(2)No praecipe shall be required.˙Filing and marking4.The
officer receiving such copy shall file the same, and an entry of
thefiling thereof shall be made in a book
(the“causebook”),
in which theaction shall be distinguished by the date of
the year and a number.˙Writs issued in
country5.When a writ of summons is issued by a
commissioner, the like entryshall be made on
receipt of the copy of the writ from the commissioner.˙Affidavit before writ in probate
actions6.Inprobateactionsanaffidavitmadebytheplaintiffor1oftheplaintiffs, verifying the endorsement
on the writ, must be filed before theissue of the
writ.
95Rules of the Supreme Court†2. Warrants in admiralty
actions˙Arrest in admiralty actions by warrant
after affidavit11.(1)In admiralty
actions in rem a warrant for the arrest of property,which
shall be in one of the forms in schedule 1, with such variations
ascircumstances may require, may be issued by
the registrar at the instanceeither of the
plaintiff or the defendant, at any time after the writ of
summonshas been issued.(2)But,
except by leave of the Court or a Judge, a warrant of arrest
shallnot be issued until an affidavit by the party
or the party’s agent setting forththeparticularsherebyprescribed,hasbeenfiled,andthefollowingprovisions have been complied with, that is
to say—(a)the affidavit shall state the name and
description of the party atwhose instance
the warrant is to be issued, and the nature of theproperty to be arrested, and that the claim
or counterclaim has notbeen satisfied, and that the aid of
the Court is required to enforceit;(b)inanactionforwages—theaffidavitshallstatethenationalcharacter of the
ship, and, if the ship is foreign, that notice of theactionhasbeenserveduponaconsularofficeroftheStatetowhich the ship belongs, if there is
one resident in Queensland;(c)in
an action for necessaries—the affidavit shall state the
nationalcharacter of the ship, and that, to the best
of the deponent’s belief,no owner or part owner of the ship is
domiciled in Queensland atthe time of the commencement of the
action;(d)inanactionbetweenco-ownersrelatingtotheownership,possession,employment,orearningsofashipregisteredinQueensland—the affidavit shall state the
port at which the ship isregisteredandthenumberofsharesintheshipownedbytheparty
proceeding;(e)in an action of bottomry—the bottomry
bond, and, if it is in aforeignlanguage,alsoanotarialtranslationthereof,shallbeproducedfortheinspectionandperusaloftheregistrar,andacopyofthebond,orofthetranslationthereof,certifiedtobecorrect, shall be annexed to the
affidavit.
96Rules of the Supreme Court˙Arrest without affidavit by
leave12.(1)The Court or a
Judge may in any case, if the Court or Judge thinkfit,
allow the warrant to issue, although the affidavit in rule 11
mentionedmay not contain all the prescribed
particulars.(2)The Court or Judge may also, in an
action for wages against a foreignship, dispense
with the service of the notice, and, in an action of
bottomry,with the production of the bond.†ORDER 8—CONCURRENT WRITS˙Concurrent writ, how issued1.(1)The plaintiff in
any action may, at the time of, or at any time during12
months after, the issuing of the original writ of summons, issue 1
ormore concurrent writ or writs.(2)Each concurrent writ shall bear teste
of the same day as the originalwrit, and shall
be marked with a seal bearing the word ‘concurrent’, and thedate
of issuing the concurrent writ; and such seal shall be impressed
uponthe writ by the proper officer.(3)However, any such concurrent writ or
writs shall only be in force forthe period during
which the original writ in the action is in force.˙Concurrent writs for service, within
and without the jurisdiction2.A
writ of summons to be served out of the jurisdiction, or of
whichnotice is to be given out of the
jurisdiction, may be issued and marked as aconcurrent writ
with a writ to be served within the jurisdiction; and a writ
ofsummons to be served within the jurisdiction
may be issued and marked asa concurrent writ
with a writ to be served out of the jurisdiction, or of
whichnotice is to be given out of the
jurisdiction.
97Rules of the Supreme Court†ORDER 9—RENEWAL OF WRITS—LOST
WRITS˙Original writ in force for 12 months,
but may be renewed1.(1)Original writs
of summons shall be in force for 12 months fromthe day of the
date thereof, including the day of such date, and no longer;but
if any defendant therein named has not been served within that
time, theplaintiff may, before the expiration of the
12 months or within such furthertime (if any) as
the Court or a Judge may allow, apply to the Court or aJudge
for leave to renew the writ; and the Court or Judge, if satisfied
thatreasonable efforts have been made to serve
such defendant, or for othergood reason, may
order that the original or concurrent writ of summons berenewed for 12 months from the date of such
renewal, inclusive of suchdate, and so from time to time during
the currency of the renewed writ.(2)The
writ shall be renewed by being marked with the word
‘renewed’,and with a seal bearing the date of the day,
month, and year of renewal;which seal shall
be provided and kept for that purpose at the registry, andshall
be impressed upon the writ by the proper officer, upon delivery to
theproper officer by the plaintiff or the
plaintiff’s solicitor of a memorandumintheforminschedule1,withsuchvariationsascircumstancesmayrequire.(3)A
writ of summons so renewed shall remain in force and be
availabletopreventtheoperationofanystatutewherebythetimeforthecommencement of the action may be
limited, and for all other purposes,from the date of
the issuing of the original writ.˙Evidence of renewal2.The
production of a writ of summons purporting to be marked withthe
seal of the Court, showing the same to have been renewed in
manneraforesaid, shall be sufficient evidence of
its having been so renewed, and ofthe commencement
of the action as of the date of the original writ, for allpurposes.˙Lost
writ3.When a writ of which the production is
necessary has been lost, the
98Rules of the Supreme CourtCourtoraJudge,uponproductionofacopythereof,anduponbeingsatisfied of the loss, and of the correctness
of the copy, may order that suchcopy shall be
sealed and served, or otherwise made use of, in lieu of theoriginal writ.†ORDER 10—SERVICE OF ORIGINATINGPROCEEDINGS†1.
Generally˙Personal service1.(1)Unless otherwise prescribed or allowed,
service of an originatingproceeding shall be made
personally.(1A)Butpersonalserviceshallnotberequiredwhenthepartytobeserved, by the party’s solicitor,
undertakes in writing to accept service, andenters an
appearance.(2)Whereadefendant’ssolicitorendorsesonthewritorotheroriginatingproceedingastatementthatthedefendant’ssolicitoracceptsservice thereof
on behalf of that defendant, the writ or other originatingproceeding shall be deemed to have been duly
served on that defendant andto have been so
served on the date on which the endorsement was made.˙Personal service, how effected2.Personal service shall be effected, in
the case of a writ of summons,originating
summons, or other document authenticated by signature or
seal,by delivering to and leaving with, or
offering to deliver to and leave with,the person to be
served a copy of the writ, summons, or other document, insuchaconditionastobeopenforexamination,andatthesametimeshowing the
person the original writ, summons, or other document, if theperson requires it; and, in the case of any
other document, by delivering oroffering to
deliver the same to the person to be served in such a condition
asto be open for examination.
99Rules of the Supreme Court†2. On particular defendants˙Husband and wife3.When
husband and wife are both parties to a cause or matter, theyshall
both be served unless the Court or a Judge otherwise orders.˙Infants4.When
an infant is a party to a cause or matter, service on the
infant’sfather or guardian, or, if the infant has
none, then upon the person withwhom the infant
resides or under whose care the infant is, shall, unless theCourt
or a Judge otherwise orders, be deemed good service on the
infant;but the Court or Judge may order that service
made or to be made on theinfant personally shall be deemed good
service.˙Mentally ill persons5.When a mentally ill person is a party
to a cause or matter, service onthe committee (if
any) of his or her person or estate, as the case may be, or,if
the person has not been declared to be mentally ill, or if the
person hasbeen so declared but a committee of his or
her person or estate, as the casemaybe,hasnotbeenappointed,serviceonthepersonwithwhomtheperson resides or under whose care the
person is, shall, unless the Court ora Judge otherwise
orders, be deemed good service on such party.†3. On
corporations and other bodies˙Service on corporations etc.6.In the absence of any statutory
provision regulating service of process,an originating
proceeding to be served on a corporation aggregate, whetherincorporated under the law of Queensland or
not, may be served on themayor or other head officer, or on the
chief executive officer, manager, orother chief
officer, or secretary or other similar officer, of such
corporationin Queensland; and when by any statute
provision is made for service ofany legal process
upon any corporation, or upon any society or
fellowship,
100Rules of the Supreme Courtor
any body or number of persons, whether corporate or unincorporate,
anoriginating proceeding may be served in the
manner so provided.†4. In particular actions˙Service in action for recovery of
land7.Service of a writ of summons in an
action to recover land may, in caseofvacantpossession,whenitcannotbeeffectedonthedefendantpersonally, be
made by posting a copy of the writ upon the door of thedwelling house, or, if there is no dwelling
house, then on some conspicuouspart of the
property.˙Service of writ on agent of oversea
principal8.(1)Where the Court
is satisfied on an ex parte application that—(a)a
contract has been entered into within the jurisdiction with
orthrough an agent who is either an individual
residing or carryingon business within the jurisdiction or
a body corporate having aregistered office or a place of
business within the jurisdiction; and(b)the
principal for whom the agent was acting was at the time thecontractwasenteredintoandisatthetimeoftheapplicationneither such an
individual nor such a body corporate; and(c)at
the time of the application either the agent’s authority has
notbeen determined or the agent is still in
business relations with theagent’s
principal;the Court or a Judge may authorise service of
a writ beginning an actionrelating to the contract to be effected
on the agent instead of the principal.(2)An
order under this rule authorising service of a writ on a
defendant’sagentshalllimitatimewithinwhichthedefendantmustenteranappearance.(3)Where an order is made under this rule
authorising service of a writon a defendant’s
agent, a copy of the order and of the writ shall be sent bypost
to the defendant at the defendant’s address out of the
jurisdiction.
101Rules of the Supreme Court˙Service of writ in pursuance of
contract9.Where—(a)theCourthasjurisdictiontohearanddetermineanyactioninrespectofacontract(whetherornotenteredintowithinthejurisdiction); and(b)the
parties to the action have agreed that, in the event of any
suchaction being begun in the Court against any
of them, the writ bywhich the action is begun may be
served on the defendant in suchmanner, or on
such other person on the defendant’s behalf or atsuch
place (whether within or out of the jurisdiction) as may bespecified in the agreement; and(c)the writ is served in accordance with
the agreement;then, notwithstanding anything in rule 1(1)
or in order 11, the writ shall bedeemed to have
been duly served on the defendant.˙Service when dispensed with in admiralty
actions in rem11.Inadmiraltyactionsinrem,serviceofthewritofsummonsorwarrant of arrest shall not be required when
the defendant agrees to acceptservice and to
put in bail, or to pay money into court in lieu of bail.˙Service of warrant of arrest in
admiralty actions12.In admiralty actions in rem the
warrant of arrest shall be served bythe marshal or
the marshal’s officer, and the party issuing the warrant
shall,within 6 days from the service thereof, file
the same in the registry with acertificate of
service endorsed thereon.˙Mode of service of
writ of summons in rem and warrants13.(1)In
admiralty actions in rem, the service of a writ of summons
inrem, or warrant against a ship, cargo,
freight, or other property, shall beeffected as
follows—(a)upon a ship, or upon cargo, freight,
or other property, if the cargoor other
property is on board a ship—by nailing or affixing theoriginal writ or warrant for a short time on
the mainmast or on
102Rules of the Supreme Courtthe
single mast of the ship, or on some other conspicuous part
ofthe ship, and on removing the writ or
warrant leaving a true copyof it nailed or
affixed in its place;(b)uponcargo,freight,orotherproperty,ifthecargoorotherproperty is not
on board a ship—by placing the writ or warrantfor a short time
on the cargo or property, and on removing thewrit or warrant
leaving a true copy thereon;(c)upon
freight in the hands of any person—by showing the writ orwarrant to the person, and leaving with the
person a true copy.(2)When the action is against proceeds in
court, a warrant to arrest shallnot be necessary,
but the writ shall be served upon the registrar, and a
caveatpayment entered as hereinafter provided, and
such service and entry shall bea sufficient
arrest of the proceeds.˙When no access to
cargo14.If cargo is in the custody of a person
who will not permit access to it,service of the
writ or warrant may be made by showing it to the custodianand
leaving with the custodian a true copy, and also publishing a copy
insome newspaper ordinarily circulating in the
locality where the cargo is.†5.
Endorsement of date of service˙Endorsement to be made on writ within 3
days15.The person serving a writ of summons
shall, within 3 days after suchservice, endorse
on the writ the day of the month and week of the servicethereof; otherwise the plaintiff shall not,
without leave of the Court or aJudge, be at
liberty, in case of default of appearance, to proceed as
upondefault; and every affidavit of service of
such writ shall mention the day onwhich such
endorsement was made.
103Rules of the Supreme Court†6. Substituted service˙Substituted service may be
allowed16.If it is made to appear to the Court
or a Judge or registrar that a partyis from any cause
unable to effect prompt personal service, or service in anyotherprescribedmanner,oftheoriginatingproceeding,oranyotherproceedingrequiringservice,theCourtorJudgeorregistrarmaymakesuchorderforsubstitutedservice,orforthesubstitutionforserviceofnotice, by advertisement or otherwise, as may
seem just.˙Evidence17.Every application to the Court or a Judge or
registrar for an order forsubstituted or other service, or for
the substitution of notice for service, shallbesupportedbyanaffidavitsettingforththegroundsuponwhichtheapplication is made.†ORDER
11—SERVICE OUT OF THE JURISDICTION˙Service outside Australia1.(1)In
this rule—“Australia”includes the
external territories.“proceeding”means—(a)the cause or matter in respect of
which an originating proceedingis issued;
or(b)an action mentioned in order 3, rule
28.“process”means—(a)an originating proceeding; or(b)a notice of an originating proceeding;
or(c)a notice of judgment or order under
order 3, rule 28.
104Rules of the Supreme Court(2)Aprocessinrelationtoaproceedingmaybeservedonapersonoutside
Australia, without the leave of the Court, if any of the
followingparagraphs apply—(a)theproceedingisfoundedonacauseofactionarisinginQueensland;(b)the
subject matter of the proceeding is—(i)property situated in Queensland; or(ii)theperpetuationoftestimonyrelatingtopropertyinQueensland;(c)anyAct,deed,will,contract,obligationorliabilityaffectingpropertysituatedinQueenslandissoughttobeconstrued,rectified, set
aside or enforced in the proceeding;(d)theproceedingisforanyreliefagainstapersondomiciledorordinarily resident in
Queensland;(e)the proceeding is for—(i)theadministrationoftheestateofapersonwhodieddomiciled in
Queensland; or(ii)anyreliefthatmightbeobtainedinaproceedingfortheadministration of the estate of a
person who died domiciledin Queensland;(f)the
proceeding is for the execution of a trust and—(i)the
trust is created or declared by an instrument; and(ii)the person is a
trustee; and(iii)the execution
relates to trust property situated in Queensland;and(iv)thetrustoughttobeexecutedaccordingtothelawofQueensland;(g)the
proceeding is to enforce, rescind, dissolve, rectify, annul
orotherwise affect, or to recover damages or
other relief in relationto the breach of, a contract
that—(i)was made in Queensland; or(ii)wasmadeby1ormorepartiescarryingonbusinessor
105Rules of the Supreme Courtresiding in Queensland; or(iii)was made by or
through an agent carrying on business orresiding in
Queensland on behalf of a principal carrying onbusiness or
residing outside Queensland; or(iv)is
governed by the law of Queensland;(h)the
proceeding is founded on a breach of contract committed inQueensland,regardlessofwherethecontractwasmadeandwhetherornotthebreachwasprecededoraccompaniedbyabreach(whereveroccurring)thatrendersimpossibletheperformance of a part of the contract that
ought to be performedin Queensland;(i)the
proceeding is founded on a contract that contains a term bywhich the parties agree to submit to the
jurisdiction of the Court;(j)the proceeding
is for the recovery of an amount payable under anAct
to a person or body in Queensland;(k)the
proceeding is founded on a tort committed in Queensland;(l)the proceeding is for damage
that—(i)was suffered in whole or part in
Queensland; and(ii)wascausedbyatortiousactoromission(whereverhappening);(m)theproceedingaffectsthepersoninrelationtotheperson’smembership
of—(i)a corporation incorporated in
Queensland; or(ii)apartnershiporanassociationorotherbody(whethercorporate or
unincorporate) formed, or carrying on any partof its affairs,
in Queensland;(n)the proceeding is for a contribution
or indemnity for a liabilityenforceable in
the Court;(o)the proceeding is for an injunction
ordering the defendant to do,or refrain from
doing, anything in Queensland (whether or notdamages are also
claimed);(p)theproceedingisproperlybroughtinQueenslandagainsta
106Rules of the Supreme Courtperson and another person outside Queensland
is a necessary orproper party to the proceeding;(q)theproceedingisbroughtundertheCivilAviation(Carrier’sLiability) Act
1959(Cwlth)—(i)by a
resident of Queensland; or(ii)in relation to
damage that happened in Queensland;(r)the
person has submitted to the jurisdiction of the Court;(s)thesubjectmatteroftheproceeding,sofarasitconcernstheperson, is property in Queensland;(t)the proceeding concerns the
construction, effect or enforcementof—(i)an Act; or(ii)an
Imperial or Commonwealth Act that affects property inQueensland;(u)the
proceeding concerns the effect or enforcement of an
executive,Ministerial or administrative act done, or
purported to have beendone, under an Act;(v)the proceeding relates to an
arbitration held in Queensland;(w)theproceedingisforthewardship,custody,managementorwelfare of an infant, or a mentally ill
person, who is domiciled orpresent in, or a
resident of, Queensland;(x)theproceeding,sofarasitconcernstheperson,fallspartlywithin 1 or more
of paragraphs (a) to (w).(3)Each paragraph
of subrule (2) is to be construed independently of theother
paragraphs and the construction of a paragraph is not to be taken
toaffect the construction of another
paragraph.˙Service of notice of originating
proceeding2.Unless service is to be effected in
any State or Territory, notice of theoriginating
proceeding, and not the originating proceeding itself, is to
beserved.
107Rules of the Supreme Court˙Mode of service3.(1)Subject to the following provisions of this
rule, order 10, rules 1and 16 shall apply in relation to the
service of an originating proceeding ornotice thereof,
notwithstanding that the originating proceeding or notice is
tobe served out of the jurisdiction.(2)Nothing in this rule, or in any order
or direction of the Court or aJudge made by
virtue of it, shall authorise or require the doing of
anythingin a country in which service is to be
effected which is contrary to the law ofthat
country.(3)Noticeofanoriginatingproceedingwhichisservedoutofthejurisdictionneednotbeservedpersonallyonthepersonrequiredtobeserved so long as
it is served on the person in accordance with the law ofthe
country in which service is effected.˙Liberty to proceed4.The
Court or a Judge, upon being satisfied by affidavit that the case
issuch that, under rule 1, the originating
proceeding, or notice thereof, may beserved out of the
jurisdiction, and that it was served upon a party out of thejurisdiction, either personally, or in
accordance with an order made underorder10,rule16,or(beinganoticeoftheoriginatingproceeding)inaccordance with the law of the country in
which service was effected, or thatreasonable
efforts were made to effect service in any such manner upon
theparty and that it came to the party’s notice,
and either that the party wilfullyneglects to
appear in the cause or matter, or that the party is living out of
thejurisdiction in order to defeat or delay the
plaintiff or petitioner, may directfrom time to time
that the plaintiff or petitioner shall be at liberty to
proceedin the cause or matter in such manner and
subject to such conditions as tothe Court or
Judge may seem fit.˙Service of summons, notices and orders
in pending proceedings4A.(1)Subjecttosubrule(2),serviceoutofthejurisdictionofanysummons,noticeororderissued,given,ormadeinanyproceedingsispermissible with the leave of the
Court.(2)Wheretheproceedingsarefortheappointmentorremovalofanarbitrator or umpire or for leave to
enforce an award or to remit or set aside
108Rules of the Supreme Courtan
award, service of the summons, notice of motion or order shall not
beallowed unless the arbitration to which it
relates is to be or has been heldwithin the
jurisdiction.(3)Rule3shallapplyinrelationtoanydocumentfortheserviceofwhich
out of the jurisdiction leave has been granted under this rule as
itapplies in relation to an originating process
or notice thereof.˙Application for, and grant of, leave to
serve process out of thejurisdiction4B.(1)An
application for a grant of leave under paragraph (7) of rule
1or under rule 1A or under rule 4A must be
supported by an affidavit statingthe grounds on
which the application is made and showing in what place orcountry the person to be served is or
probably may be found.(2)No such leave
shall be granted unless it shall be made sufficiently toappear to the Court or a Judge that the case
is a proper one for service out ofthe jurisdiction
under this order.†Service of foreign legal process in
Queensland˙Letter of request from foreign
tribunal—procedure5.Where in any civil or commercial
matter pending before a court ortribunal of a
foreign country a letter of request from such court or
tribunalfor service on any person in Queensland of
any process or citation in suchmatteristransmittedtotheSupremeCourtbyHerMajesty’sAttorney-General, with an intimation that it
is desirable that effect should begiven to the
same, the following procedure shall be adopted—(a)theletterofrequestforserviceshallbeaccompaniedbyatranslation thereof in the English
language, and by 2 copies of theprocessorcitationtobeserved,and2copiesthereofintheEnglish
language;(b)service of the process or citation
shall be effected by the sheriff,or the sheriff’s
authorised agent;(c)such service shall be effected by
delivering to and leaving with thepersontobeserved1copyoftheprocesstobeserved,and
109Rules of the Supreme Court1
copy of the translation thereof, in accordance with the rules
andpractice of the Supreme Court regulating
service of process;(d)afterservicehasbeeneffectedthesheriffshallreturntotheregistrar of the Supreme Court 1 copy
of the process, togetherwith the evidence of service by
affidavit of the person effectingthe service and
particulars of charges for the cost of effecting suchservice;(e)the
registrar shall certify the correctness of the charges, or
suchother amount as shall be properly payable
for the cost of effectingservice;(f)the
registrar shall transmit to Her Majesty’s Attorney-General
theletter of request for service received from
the foreign country,together with the evidence of service,
with a certificate appendedtheretodulysealedwiththesealoftheSupremeCourt.Suchcertificate
shall be in the form in schedule 1;(g)insteadoftranslatedcopiesoftheprocessorcitationbeingforwarded with the letter of request, it
shall be sufficient if eachcopy of the
process or citation is endorsed with an annotation inthe
English language stating as precisely as possible the name
andaddress of the person upon whom the document
is to be served,the nature of the document, and the names of
the parties;(h)whentheprocessorcitationissoannotated,itshallnotbenecessary to leave with the person
served a translated copy of theprocess or
citation;(i)theregistrarshalltransmittothediplomaticconsularorotherauthority making
the request a certificate establishing the fact andthe
date of the service or indicating the reasons for which it
hasnotbeenpossibletoeffectserviceandatthesametimeshallcertifytothesaiddiplomatic,consular,orotherauthoritytheamount of the charges properly payable
for the cost of effectingservice.˙Orders
for substituted service etc.6.Upon
the application of the Crown Solicitor, with the consent of
HerMajesty’s Attorney-General, the Court or a
Judge may make all such orders
110Rules of the Supreme Courtfor
substituted service or otherwise as may be necessary to give effect
tothese rules.˙Noncompliance with rules7.The
Court or a Judge may direct that effect shall be given to a letter
ofrequestfortheserviceofprocessofaforeigncourtortribunal,notwithstanding
that all the requirements of rules 5 and 6 have not beencomplied with.˙Request from consul or consular or diplomatic
agent8.Any request for service of process
under any convention between theUnited Kingdom
and any other country respecting legal proceedings in civilorcommercialmattersmaybeforwardedbytheconsulorconsularordiplomatic agent, as the case may be, for
that country, in Brisbane, to theregistrar of the
Supreme Court, Brisbane, instead of being forwarded byHerMajesty’sAttorney-GeneraltotheSupremeCourt,asprovidedbyrule5,andthesaidregistrarmayinsuchcasereturnthedocumentsmentioned in rule
5(f) to the said consul or consular or diplomatic agent,and
such consul or consular or diplomatic agent may make application
forsubstituted service as provided by rule
6.†ORDER 12—APPEARANCE˙Appearance to writ of summons1.Adefendantshallenterthedefendant’sappearancetoawritofsummons in Brisbane, Rockhampton, Townsville
or Cairns, or in a districtregistry
according to the exigency of the writ.˙Filing
memorandum of appearance2.(1)Apartyentersanappearancebyfilingamemorandumofappearance in duplicate.
111Rules of the Supreme Court(2)The memorandum must be dated—(a)if it is lodged for filing
personally—on the day it is lodged forfiling;
or(b)if it is lodged for filing by post—on
the day it is posted.(3)The memorandum
must state the name of the party’s solicitor or thatthe
party appears in person.(4)Theproperofficermustsealtheduplicatememorandumwiththeoffice seal and return it to the filing
party.(5)The sealed duplicate memorandum is
evidence the person entered anappearance on the
day indicated by the seal.Notice of appearance3.(1)A defendant who
lodges a memorandum of appearance for filingby post must, on
the day it is posted, give a copy to the plaintiff.(2)The copy may be served personally,
sent by prepaid post or sent byfacsimile.(3)On the day a defendant receives the
sealed duplicate memorandum ofappearancefromtheproperofficer,thedefendantmustgiveittotheplaintiff.(4)The memorandum may be served
personally or sent by prepaid post.(5)Subrule (3) applies whether the memorandum
was lodged for filingpersonally or by post.(6)In this rule—“plaintiff”means the plaintiff’s solicitor or, if the
plaintiff sues in person,the plaintiff.˙Defendant’s address for service—document
exchange address4.(1)The solicitor of
a defendant appearing by a solicitor shall state insuch
memorandum the solicitor’s name or firm and place of business
andtelephonenumberand,ifthesolicitorhasfacilitiesforthereceptionofdocuments in a document exchange, the
document exchange address andalso, if the
solicitor’s place of business is distant more than 10 km from
the
112Rules of the Supreme Courtregistry, a place to be called the
solicitor’s address for service, which shallnot be more than
10 km from the registry, where any proceedings in theaction may be left for the solicitor.(2)And, if such solicitor is only agent
of another solicitor, the solicitorshall add to the
above particulars the name or firm and place of businessand
telephone number and if applicable the document exchange address
ofthe principal solicitor.˙Defendant appearing in person5.A defendant appearing in person shall
state in such memorandum thedefendant’s
address and telephone number (if any) and also a place, to
becalled the defendant’s address for service,
which shall not be more than10 km from the
registry.˙Irregular memorandum—fictitious
address6.Ifthememorandumdoesnotcontainsuchaddressitshallnotbereceived; and, if any such address is
illusory or fictitious, the appearancemay be set aside
by the Court or a Judge on the application of the plaintiff.˙Memorandum of appearance7.The memorandum of appearance shall be
in the form in schedule 1with such variations as circumstances
may require.˙Officer to enter memorandum8.Upon receipt of a memorandum of
appearance, the proper officer shallforthwith enter
the appearance in the cause book.˙Defendants appearing by same solicitor9.If 2 or more defendants in the same
cause appear by the same solicitorand at the same
time, the names of all the defendants so appearing shall beinserted in 1 memorandum.
113Rules of the Supreme Court˙Solicitor not entering
appearance10.Asolicitorwhofailstoenteranappearanceinpursuanceofthesolicitor’s written undertaking so to
do, or who fails to put in security in anadmiralty action
in rem, in pursuance of a like undertaking, shall be liable
toattachment.˙Time
for appearance11.(1)A defendant may
appear at any time before judgment.(2)If
the defendant appears after the time limited for appearance,
thedefendant shall not, unless the Court or a
Judge otherwise orders, be entitledtoanyfurthertimefordeliveringhisorherdefence,orforanyotherpurpose, than if
the defendant had appeared according to the exigency of thewrit.˙Recovery of land12.Any
person not named as a defendant in a writ of summons for therecovery of land may appear and defend, on
filing an affidavit showing thatthe person is in
possession of the land either personally or by the person’stenant.˙Landlord appearing13.Any
person appearing to defend an action for the recovery of land
aslandlord, in respect of property whereof the
person is in possession only bythe person’s
tenant, shall state in the appearance that the person appears
aslandlord.˙Recovery of land, person not named
defendant14.(1)When a person
not named as defendant in a writ of summons fortherecoveryoflandappearsanddefends,thepersonshallenteranappearance, according to the foregoing rules
of this order, entitled in theaction against
the party named in the writ as defendant, and shall
forthwithgive notice of such appearance to the
plaintiff’s solicitor, or to the plaintiff ifthe plaintiff
sues in person.
114Rules of the Supreme Court(2)In all subsequent proceedings the
person shall be named as a partydefendant to the
action.˙Recovery of land, limiting
defence15.(1)Any person
appearing to a writ of summons for the recovery ofland
shall be at liberty to limit his or her defence to a part only of
the landmentioned in the writ, describing that part
with reasonable certainty in theperson’s
memorandum of appearance, or in a notice intituled in the
actionand signed by the person or the person’s
solicitor.(2)Such notice shall be served within 4
days after appearance; and anappearance, when
the defence is not limited as above mentioned, shall bedeemed an appearance to defend for the
whole.˙Form of notice16.The
notice mentioned in rule 15 shall be in the form in schedule
1with such variations as circumstances may
require.˙Probate intervention17.In probate actions any person not
named in the writ may interveneand appear in the
action on filing an affidavit showing that the person isinterested in the estate of the
deceased.˙Admiralty intervention21.In an admiralty action in rem, any
person not named in the writ mayinterveneandappearonfilinganaffidavitshowingthatthepersonisinterested in the res under arrest, or in the
fund in court.˙Conditional appearance22.(1)Adefendantinanycausemayenteraconditionalappearancedenying the
jurisdiction of the Court, and shall not thereby be deemed
tohave submitted to such jurisdiction, except
as to the costs occasioned by theappearance or by
any application under this rule; and the defendant maythereupon apply to the Court or Judge for an
order to set aside the service
115Rules of the Supreme Courtupon
the defendant of the originating proceeding, or the service upon
thedefendant of notice thereof, as the case may
be.(2)Or the defendant may make such
application before appearing, andwithout entering
a conditional appearance.(3)If the defendant
enters a conditional appearance, and does not makesuch
application promptly, the Court or Judge may set aside the
conditionalappearance with costs, to be paid by the
defendant by whom it was entered.(4)If
the application is made and dismissed, the conditional
appearanceshall be struck out, and the defendant may
enter an appearance as in othercases.†2. Persons under disability˙Appearance by infant23.An order for the appointment of a
guardianad litemof an infant in
anactionshallnotbenecessary,butthesolicitorapplyingtoenteranappearance for the infant shall make and file
an affidavit in the form inschedule 1, with
such variations as circumstances may require.˙Guardian ad litem in matters other than
actions24.(1)An infant served
with an originating proceeding in any cause ormatter,notbeinganaction,mayappearonthehearingofthecauseormatter by a guardianad litemin
all cases in which the appointment of aspecial guardian
is not provided for.(2)An order for the appointment of such
guardian shall not be necessary,but the solicitor
by whom the infant appears shall previously make and filean
affidavit as in rule 23 mentioned.˙Other
cases25.When proceedings in any cause or
matter are directed to be continuedby or against an
infant, or an infant is at liberty to attend any proceedings
ina cause or matter, the infant shall appear as
in rule 24 directed.
116Rules of the Supreme Court†ORDER 13—PROCEEDINGS BY AND
AGAINSTPAUPERS˙Suing
or defending as pauper1.Any person may
be allowed by the Court or a Judge to sue or defendin
any cause or matter as a pauper on proof that the person is not
worth£100 ($200), the person’s wearing apparel and
the subject matter of thecause or matter (if any) only
excepted.˙Case to be laid before counsel2.A person desirous of suing as a pauper
shall lay a case before counselfor counsel’s
opinion whether or not the person has reasonable grounds forproceeding.˙Affidavit by party or solicitor that case is
true3.A person shall not be permitted to sue
as a pauper unless the case laidbefore counsel
for counsel’s opinion, and counsel’s opinion thereon, withan
affidavit of the party, or the party’s solicitor, stating that the
case containsa full and true statement of all the material
facts to the best of his or herknowledge and
belief, and referring to the case as an exhibit, are
producedbefore the Court or Judge to whom the
application is made.˙No court fees
payable5.A person admitted to sue or defend as
a pauper shall not be liable toany court
fees.˙Counsel and solicitor may be
assigned6.When a person is admitted to sue or
deferred as a pauper, the Court ora Judge may, if
necessary, assign a counsel or solicitor, or both, to assist
theperson; and a counsel or solicitor so
assigned shall not be at liberty to refusehis or her
assistance unless he or she satisfies the Court or Judge that he
orshe has some good reason for
refusing.
117Rules of the Supreme Court˙Default in proceeding by pauper7.When a person who has been admitted to
sue as a pauper neglects toproceed with the
cause or matter, the person may be ordered to pay costs,although the person has not been dispaupered;
and all further proceedings inthe cause or
matter may be stayed until payment of any costs so ordered
tobe paid by the person.˙Notices etc. on behalf of pauper, how to be
signed8.A notice of motion shall not be served
or summons issued, nor shall apetition be
presented, on behalf of any person admitted to sue or defend as
apauper, except for the discharge of the
person’s solicitor, unless it is signedby the person’s
solicitor.˙Duty of solicitor9.It
shall be the duty of the solicitor assigned to a person admitted to
sueor defend as a pauper to take care that no
notice is served, or summonsissued, or
petition presented, without good cause.˙Pauper
not to recover costs10.A person admitted to sue or defend as
a pauper shall not be entitled torecovercostsfromanyotherpartywithouttheorderoftheCourtoraJudge.˙Taxation of costs11.Costs ordered to be paid to a person
admitted to sue or defend as apauper shall,
unless the Court or Judge otherwise directs, be taxed as inother
cases.
118Rules of the Supreme Court†ORDER 14—DISCLOSURE BYSOLICITORS—CHANGE OF SOLICITORS˙Where name of solicitor endorsed on
writ1.Every solicitor whose name is endorsed
on any originating proceedingshall, on demand
in writing made by or on behalf of any party who hasbeen
served therewith or has appeared thereto, declare forthwith in
writingwhether such originating proceeding has been
issued or delivered by thesolicitororwiththesolicitor’sauthorityorprivity;andifsuchsolicitordeclares that the originating proceeding was
not issued or delivered by thesolicitor or with
the solicitor’s authority or privity, all proceedings upon
thesameshallbestayed,andnofurtherproceedingsshallbetakenthereonwithout leave of the Court or a Judge.˙Change of solicitor by notice2.(1)In any cause or
matter, a party suing or defending by a solicitorshall
be at liberty to change his or her solicitor without an order for
thatpurpose, upon notice of such change being
filed in the registry and servedontheoppositeparty;butuntilsuchnoticeisfiled,andacopythereofserved, the former solicitor shall be
considered the solicitor of the party untilthe final
conclusion of the cause or matter.(2)The
notice must give the address and address for service of the
newsolicitor, as prescribed in the case of writs
issued and appearances enteredby a
solicitor.˙Proceedings continued by
solicitor3.(1)When a party has
sued in person, or has appeared in person, andsuch party by a
solicitor of the Court gives notice in writing to the
oppositeparty, that such solicitor is authorised to
act as solicitor for the party onwhosebehalfsuchnoticeisgiven,allproceedingsandwrittencommunications
which are required to be delivered to or served upon theparty
on whose behalf such notice is given shall thereafter be delivered
to orserved upon such solicitor.(2)Thenoticemustgivetheaddressandaddressforserviceofthe
119Rules of the Supreme Courtsolicitor, as prescribed in the case of writs
issued and appearances enteredby a
solicitor.˙Removal of solicitor3A.(1)Where a
solicitor who has acted for a party in a cause or matterhas
died or become bankrupt or cannot be found or has failed to take
out apractisingcertificateorhasbeenstruckofftheRollofSolicitorsorsuspended from practice as a solicitor, and
the party has not given notice ofchange of
solicitor or notice of intention to act in person in accordance
withthe provisions of rule 2, any other party to
the cause or matter may, onnotice to be
served on the firstnamed party personally or by letter
addressedtotheparty’slastknownplaceofaddress,unlesstheCourtorJudgeotherwise
directs, apply to the Court or Judge for an order declaring that
thesolicitor has ceased to be the solicitor
acting for the firstnamed party in thecause or matter,
and the Court or Judge may make an order accordingly.(2)Wheretheorderismade,thepartyapplyingfortheordershallforthwith give a
notice (a“notice of removal”) to the same
effect as theorder, and the provisions of this order shall
apply to the notice of removalwith the
necessary modifications and subject to any direction in the order
asto service on the firstnamed party.(3)Where the party who applied for the
order has complied with theprovisions of
this order, the firstnamed party shall either appoint
anothersolicitor or else give such an address for
service as is required of a partyacting in person,
and shall comply with the provisions of rule 2 relating tonotice of appointment of a solicitor or
notice of intention to act in person,and in default of
the party so doing, any documents in respect of whichpersonal service is not requisite may be
served on the party so in default bybeing filed in
the registry.(4)Anyordermadeunderthisruleshallnotaffecttherightsofthesolicitor and the party for whom he or
she acted as between themselves.˙Withdrawal of solicitor3B.(1)Where a solicitor who has acted for a party
in a cause or matterhasceasedsotoactandthepartyhasnotgivennoticeofchangeinaccordance with the provisions of rule 2, the
solicitor may on notice to be
120Rules of the Supreme Courtservedonthepartypersonallyorbyletteraddressedtotheparty’slastknown place of
address, unless the Court or Judge otherwise directs, applyto
the Court or Judge for an order to the effect that the solicitor
has ceased tobe the solicitor acting for the party in the
cause or matter, and the Court orJudge may make an
order accordingly.(1A)However,untilandunlessthesolicitorhascompliedwiththeprovisions of this rule the solicitor
shall (subject to the provisions of rules 2and 5) be
considered the solicitor of the party to the final conclusion of
thecause or matter.(2)Where the order is made, the solicitor shall
forthwith give a notice (a“notice of withdrawal”) to
the same effect as the order and the provisionsofrule2shallapplytothenoticeofwithdrawalwiththenecessarymodifications and
subject to any directions in the order as to service on theparty.(3)Where the solicitor has complied with the
said provisions the partyshall either appoint another solicitor
or else give such an address for serviceasisrequiredofapartyactinginperson,andshallcomplywiththeprovisions of rule 2 relating to notice of
appointment of a solicitor or noticeofintentiontoactinperson,andindefaultofthepartysodoing,anydocumentinrespectofwhichpersonalserviceisnotrequisitemaybeserved on the party so in default by
being filed in the registry.(4)Anyordermadeunderthisruleshallnotaffecttherightsofthesolicitor and the party as between
themselves.˙Register of town solicitors’
addresses4.The registrar shall keep at the
registry a book which shall be open to beinspected by any
solicitor or solicitor’s clerk, without fee or reward; andevery
solicitor practising in the Court without the intervention of a
townagentshallcausetobeenteredinsuchbookinalphabeticalorderthesolicitor’s name and place of business,
and, if that place is distant more than10 km from the
registry, another place within 10 km of the registry wherethesolicitormaybeservedwithproceedings;andasoftenasanysuchsolicitor changes
his or her place of business or the place where the
solicitormay be so served as aforesaid, the solicitor
shall cause the like entry thereoftobemadeinthesaidbook;andallproceedingsandwrittencommunicationswhichdonotrequirepersonalserviceshallbedeemed
121Rules of the Supreme Courtsufficiently served on such solicitor if a
copy thereof is left at the place lastlyentered in such
book with any person resident at or belonging to such place;and
if any such solicitor neglects to cause such entry to be made, the
fixingupofanynotice,orthecopyofanyproceeding,oranywrittencommunication for
such solicitor, in the registry, shall be deemed sufficientservice on the solicitor.†ORDER 15—DEFAULT OF APPEARANCE˙Default of appearance by infant or
mentally ill person—notice ofapplication1.(1)Whennoappearanceisenteredtoawritofsummonsforadefendant who is an infant or a
mentally ill person who has not been sodeclared, the
plaintiff shall, before further proceeding with the action
againstthe defendant, apply to the Court or a Judge
for an order that some properperson be
assigned as guardian of such defendant, by whom he or she
mayappear and defend the action.(2)Such an order shall not be made unless
it appears that the writ ofsummons was duly
served, and that notice of the application was, after theexpirationofthetimeallowedforappearance,andatleast6cleardaysbefore the day in such notice named for
hearing the application, served uponor left at the
dwelling house of the person with whom or under whose caresuch
defendant is then residing, and also, if the defendant is an infant
notresiding with or under the care of the
infant’s father, mother or guardian,served upon or
left at the dwelling house of the father, mother or guardian(if
any) of the infant, unless the Court or Judge at the time of
hearing theapplication dispenses with such lastmentioned
service.(3)Whenaguardianhasbeenappointed,theguardianshallhavethesame
time for appearance after the service of the order on the guardian
as ifit were a writ of summons.˙Default of appearance generally2.Whenadefendantfailstoappeartoawritofsummons,andthe
122Rules of the Supreme Courtplaintiff is desirous of proceeding upon
default of appearance under rules 3to 17, or under
order 19, the plaintiff shall, before taking such proceedingupon
default, file an affidavit of service of the writ, or of notice in
lieu ofservice, as the case may be.˙Entry of judgment by post2A.(1)This rule
applies if the plaintiff seeks to enter judgment under thisorder
by post.(2)The documents filed to enter judgment
must include—(a)a notice stating the rule under which
the plaintiff is seeking toenter judgment;
and(b)anaffidavitbytheplaintiff,attestedonthedayitisposted,deposingthattheplaintiffhasnotreceivedacopyofamemorandum of appearance lodged for
filing by post or a sealedduplicate memorandum of
appearance.(3)The affidavit under subrule (2)(b) may
be relied on, for this rule, untilthe end of 5 days
after the day it is attested.(4)If,
before receiving the duplicate judgment, the plaintiff receives
acopy of a memorandum of appearance lodged for
filing by post or a sealedduplicate memorandum of appearance, the
plaintiff must immediately givewritten notice to
the registrar.(5)The registrar may enter judgment in
default of appearance if—(a)the documents
mentioned in subrule (2) have been filed; and(b)the
plaintiff has otherwise complied with this order in seeking
toenter judgment; and(c)theregistrarissatisfiedamemorandumofappearancehasnotbeen filed under these rules.(6)If,afterenteringjudgmentindefaultofappearance,theregistrarbecomes satisfied
a memorandum of appearance was filed under these rulesbefore judgment was entered, the registrar
must withdraw the judgment andnotify the
parties.(7)In this rule—
123Rules of the Supreme Court“plaintiff”means the
plaintiff’s solicitor or, if the plaintiff sues in person,the
plaintiff.˙Liquidated demand endorsed3.Whenthewritofsummonsisendorsedforadebtorliquidateddemandonly,whetherbyspecialendorsementorotherwise,andthedefendant fails, or all the defendants,
if more than 1, fail, to appear thereto,the plaintiff may
enter final judgment against such defendant or defendantsforanysumnotexceedingthesumendorsedonthewrit,togetherwithinterest at the
rate claimed by the endorsement as the rate agreed upon (ifany)
or, if no rate is claimed to have been agreed upon, at the rate of
10%per annum, to the date of the judgment, and
costs as provided by order 6,rule 8.˙Liquidated demand—several
defendants4.When the writ is endorsed for a debt
or liquidated demand, whether byspecialendorsementorotherwise,andthereareseveraldefendants,ofwhom
1 or more appears or appear to the writ, and another or others
fails orfail to appear, the plaintiff may enter final
judgment as by rule 3 providedagainst the
defendant or defendants so failing to appear.˙Interlocutory judgment for damages5.Iftheclaimendorsedonthewritisasagainstanydefendant,forunliquidated damages only, and that defendant
fails to appear, the plaintiffafterfilingastatementofclaimorparticularsmayenterinterlocutoryjudgment against
the defendant for damages to be assessed and costs, andproceed with the action against the other
defendants (if any).˙Detention of
goods—interlocutory judgment for return, assessment ofvalue
and damages6.(1)If the claim
endorsed on the writ is, as against any defendant, forthe
detention of goods only, and that defendant fails to appear, the
plaintiffmay enter interlocutory judgment against the
defendant for the return of thegoodsortheirvaluetobeassessedandcosts,or,attheoptionofthe
124Rules of the Supreme Courtplaintiff, interlocutory judgment for the
value of the goods to be assessedand costs, and
proceed with the action against the other defendants (if
any).(2)If the claim endorsed on the writ is,
as against any defendant, for thedetention of
goods and also for unliquidated damages, but no other claim
ismade against that defendant and that
defendant fails to appear, the plaintiffmay enter
interlocutory judgment against the defendant for the return of
thegoods or their value to be assessed, damages
to be assessed and costs, or, atthe option of the
plaintiff, interlocutory judgment for the value of the goodstobeassessed,damagestobeassessedandcosts,andproceedwiththeaction against the other defendants (if
any).(3)TheCourtoraJudgemayorderthatastatementofclaimorparticulars be filed before the assessment of
damages.˙Detention of goods, damages and
liquidated demand7.(1)If the claim
endorsed on the writ is, as against any defendant—(a)for unliquidated damages, or for the
detention of goods, or forunliquidated damages and the detention
of goods; and also(b)for a debt or liquidated demand with
or without interest;whether or not the writ is specially
endorsed, and no other claim is made asagainst that
defendant, and that defendant fails to appear, the plaintiff
mayenter against that defendant, as respects the
claim or claims for damages ordetention of
goods, such interlocutory judgment (with costs) as is
providedfor by rules 5 and 6, and such final judgment
(with costs) in respect of theclaim for a debt
or liquidated demand as is provided for by rule 3 or 15, andproceed with the action against the other
defendants (if any).(2)TheCourtoraJudgemayorderthatastatementofclaimorparticulars be filed before the assessment of
damages.˙Recovery of land8.In
an action for the recovery of land, if no appearance is entered
withinthe time limited by the writ for appearance,
or if an appearance is enteredbut the defence
is limited to part only of the land, the plaintiff may enterfinaljudgmentthatthepersonwhosetitleisassertedinthewritshallrecover possession of the land, or of the
part thereof to which the defence
125Rules of the Supreme Courtdoes
not apply, with his or her costs, upon the production of a
certificate bythe solicitor for the plaintiff or, in the
case of a plaintiff in person, of anaffidavit that
the action is not one to which order 6, rule 11B applies.˙Recovery of land and other
claims9.If the plaintiff in an action for the
recovery of land has also endorsedupon the writ a
claim for mesne profits, arrears of rent or double value orany
other claim mentioned in rules 3 to 7, the plaintiff may enter
judgmentas provided in rule 8 with respect to the
land; and may proceed as providedin the other
preceding rules with respect to the plaintiff’s other claim
soendorsed.˙Cases
where unnecessary to proceed9A.In
any case to which rules 3 to 9 do not apply, if by reason of
thedefendant’s satisfying the claim or complying
with the demands thereof orany other like
reason it has become unnecessary for the plaintiff to
proceedwiththeaction,then,ifthedefendantfailstoenteranappearance,theplaintiff may by leave of the Court or a
Judge enter judgment against thatdefendant for
costs.˙Setting aside judgment by
default10.Any judgment by default under this
order may be set aside or variedby the Court or a
Judge upon such terms as to costs or otherwise as theCourt
or Judge may think fit.˙Default of
appearance in actions not otherwise specially provided for13.In all actions not by this order
otherwise specially provided for, incase any
defendant does not appear within the time limited by the writ
forappearance, the plaintiff may, upon filing a
proper affidavit of service, and,if the writ is
not specially endorsed under order 6, a statement of claim,proceedintheactionasifsuchdefendanthadappeared;subject,nevertheless, as to admiralty actions, to the
provisions of order 39, rule 26.
126Rules of the Supreme Court˙Effect of judgment by default14.In any case in which a plaintiff
enters judgment under the provisionsof this order
against 1 or more of several defendants who fails or fail toappear, such entry of judgment shall not, nor
shall the issue of executionthereon,
prejudice the plaintiff’s right to proceed in the action against
theother defendant or defendants.15.Whereawritofsummonsisendorsedforaclaimforadebtorliquidated demand together with a claim for
interest under theCommonLaw Practice Act
1867then upon such defaults as are hereinbefore
referredto—(a)if the plaintiff
elects to abandon the claim for such interest—thewrit
of summons shall for the purposes of this order be treated
asendorsed for such debt or liquidated demand
without such interestand the plaintiff may enter judgment
accordingly; and(b)if the plaintiff elects to accept
interest at a rate not higher than thatspecified in a
practice direction issued from time to time by theChiefJusticeinrespectofanyperiodmentionedinthedirection—the
registrar has power to award interest in accordancewith
the direction (whether or not the defendant has paid the
debtor liquidated demand after action brought)
and the plaintiff mayenter judgment against the defendant
in default accordingly; and(c)if
the plaintiff seeks to recover a higher rate of interest than
thatspecified in a practice direction mentioned
in paragraph (b)—theCourtoraJudgemaydeterminetheinterest(ifany)thatisrecoverableandmaydirectthatjudgmentbeenteredfortheinterest(whetherornotthedefendanthaspaidthedebtorliquidated demand after action brought) and
may otherwise directthat judgment be entered as provided
by this order; and(d)if the period for which interest is to
be awarded is not specified inthe endorsement
on the writ, interest must be allowed only fromthe date of the
issue of the writ.16.(1)Whereawritofsummonsisendorsedforserviceoutofthejurisdiction and
leave is required pursuant to theService and
Execution of
127Rules of the Supreme CourtProcess Act 1901(Cwlth), section
11 or order 11 before the plaintiff mayproceed to enter
judgment in default of appearance pursuant to order 15,rule
3, the Judge may, if leave to proceed is given, with the consent of
theplaintiff fix a sum for costs of the
application instead of ordering a taxationthereof.(2)Where the application has been
prepared by a solicitor the sum sofixedshall,unlesstheJudgeforgoodreasonotherwiseorders,betheamount prescribed
in schedule 2, part 16 together with an amount fixed bythe
Judge for counsel’s fees (if any).17.The
costs fixed under rule 16 shall be included in the amount of
anyjudgment entered in default of appearance
pursuant to order 15, rule 3 andshall be in
addition to any costs allowable under order 6, rule 8.†ORDER 16—CHANGE OF PARTIES˙Action not abated where cause of action
continues1.A cause or matter shall not become
abated by reason of the marriage,death, or
bankruptcy of any of the parties, if the cause of action survives
orcontinues, and shall not become defective by
the assignment, creation, ordevolution of any
estate or title pendente lite.˙In
case of marriage etc. or devolution of estate, Court may
ordersuccessor to be made a party or served with
notice2.In case of the marriage, death, or
bankruptcy, or devolution of estateby operation of
law, of any party to a cause or matter, the Court or a Judgemay,ifitisnecessaryforthecompletesettlementofallthequestionsinvolved, order that the husband, personal
representative, trustee, or othersuccessor in
interest (if any) of such party shall be made a party, or shall
beserved with notice in such manner and form as
hereinafter prescribed, onsuch terms as may be just, and may make
such order for the disposal of thecause or matter
as may be just.
128Rules of the Supreme Court˙In case of assignment, creation, or
devolution of estate or title, actionmay be
continued3.In case of an assignment, creation, or
devolution, of any estate or titlependente lite,
the cause or matter may be continued by or against the
personto or upon whom such estate or title has come
or devolved.˙Order to carry on proceedings4.(1)When by reason
of marriage, death, or bankruptcy, or any otherevent occurring
after the commencement of a cause or matter, and causing achange or transmission of interest or
liability, or by reason of any personinterested coming
into existence after the commencement of the cause ormatter, it becomes necessary or desirable
that any person not already a partyshould be made a
party, or that any person already a party should be made aparty
in another capacity, an order that the proceedings shall be carried
onbetweenthecontinuingpartiesandsuchnewpartyorpartiesmaybeobtained ex parte, either by any
continuing party, or by any person whomaybemadeaparty,onapplicationtotheCourtoraJudge,uponanallegation of such change, or
transmission of interest or liability, or of suchperson interested having come into
existence.(2)If the party applying to be made a
party as plaintiff is an infant, theapplication must
be made by the infant by the infant’s next friend.˙Service of order to continue
action5.(1)Everyordermadeunderrule4shall,unlesstheCourtorJudgeotherwise
directs, be served upon the continuing party or parties, and
alsouponeachsuchnewparty,unlessthepersonmakingtheapplicationishimself or herself the only new party; and
the order shall from the time ofsuch service,
subject nevertheless to rules 6 and 7, be binding on the
personserved therewith; and every person served
therewith who is not already aparty to the
cause or matter shall be bound to enter an appearance
theretowithin the same time and in the same manner
as if the person had beenserved with a writ of summons.(2)Notice of such obligation to appear
shall be endorsed on the orderbefore
service.
129Rules of the Supreme Court˙Application to discharge order by
person under no disability orhaving a
guardian6.Whenanypersonwhoisundernodisability,orwhoisundernodisability other than coverture, or
who, being under some disability otherthan coverture,
has a guardianad litemin the cause or
matter, is served withan order made under rule 4, such person
may apply to the Court or a Judgeto discharge or
vary such order at any time within 8 days after the timeallowed for appearance.˙By
person under disability, having no guardian7.When
any person who is under any disability other than coverture,
andhas no guardianad litemin
the cause or matter, is served with an ordermadeunderrule4,suchpersonmayapplytotheCourtoraJudgetodischargeorvarysuchorderatanytimewithin8daysafterthetimeallowed for the
appearance of the person’s guardianad litemwhendulyappointed; and until such period of 8 days
has expired such order shall haveno force or
effect as against such lastmentioned person.˙Death
of sole plaintiff or defendant8.(1)When
the plaintiff or defendant in a cause dies, and the cause ofaction survives, but the plaintiff or the
person entitled to proceed fails toproceed,thedefendant,orthepersonagainstwhomthecausemaybecontinued, may apply to a Judge for an
order requiring the plaintiff or theperson entitled
to proceed to proceed within such time as may be ordered.(2)And in default the Judge may order the
cause to be dismissed forwant of prosecution, with or without
costs, as in other cases.
130Rules of the Supreme Court†ORDER 17—THIRD PARTY AND
SIMILARPROCEEDINGS˙Third
party notice1.(1)Where in any
action a defendant who has entered an appearance—(a)claimsagainstapersonnotalreadyapartytotheactionanycontribution or indemnity; or(b)claims against such a person any
relief or remedy relating to orconnectedwiththeoriginalsubjectmatteroftheactionandsubstantially the same as some relief or
remedy claimed by theplaintiff; or(c)requires that any question or issue relating
to or connected withthe original subject matter of the
action should be determined notonlyasbetweentheplaintiffandthedefendantbutalsoasbetween either or both of them and a person
not already a party tothe action;then, subject to
subrule (2), the defendant may issue a notice in the form inschedule 1 (a“third party
notice”) containing a statement of the nature
ofthe claim made against the defendant and, as
the case may be, either of thenature and
grounds of the claim made by the defendant or of the question
orissue required to be determined.(2)A defendant to an action may not issue
a third party notice withoutthe leave of the
Court or a Judge unless the defendant issues and serves thenotice before delivering his or her defence
to the plaintiff.(3)Where a third party notice is served
on the person against whom it isissued, the
person shall as from the time of service be a party to the
action(a “third party”) with the same
rights in respect of the person’s defenceagainst any claim
made against the person in the notice and otherwise as ifthe
person had been duly sued in the ordinary way by the defendant
bywhom the notice is issued.˙Application for leave to issue third
party notice2.(1)Application for
leave to issue a third party notice may be made exparte
but the Court or a Judge may direct a summons for leave to be
issued.
131Rules of the Supreme Court(2)Anapplicationforleavetoissueathirdpartynoticemustbesupported by an affidavit
stating—(a)the nature of the claim made by the
plaintiff in the action; and(b)the
stage which proceedings in the action have reached; and(c)the nature of the claim made by the
applicant or particulars of thequestion or
issue required to be determined, as the case may be,and
the facts on which the proposed third party notice is based;and(d)the name and
address of the person against whom the third partynotice is to be issued.˙Issue
and service of, and entry of appearance to, third party
notice3.(1)The order
granting leave to issue a third party notice may containdirections as to the period within which the
notice is to be issued.(2)There shall be
served with every third party notice a copy of the writby
which the action was begun and of the pleadings (if any) served in
theaction.(3)Subjecttotheforegoingprovisionsofthisrule,thefollowingprovisionsofthewithinrules,namelyorder5,rule9,order10(exceptrule 15), order
11 (except rule 2), and order 12, shall apply in relation to
athird party notice and to the proceedings
begun thereby as if—(a)thethirdpartynoticewereawritandtheproceedingsbegunthereby were an action; and(b)the defendant issuing the third party
notice were a plaintiff and theperson against
whom it is issued a defendant in that action.(4)A
defendant who issues a third party notice shall not later than 4
daysafter the date on which the notice is served
on the third party serve a copythereof on all
other parties to the action.˙Pleadings and third party directions4.(1)Subject to any
order of the Court or a Judge—(a)a
defendant who issues a third party notice shall deliver with
the
132Rules of the Supreme Courtnotice a statement of claim against the
third party; and(b)a third party who has entered an
appearance shall deliver his orherdefencetothestatementofclaimofthedefendantwithin28
days from the time limited for the third party’s appearance
orfrom the delivery of the statement of claim
whichever is the later;and(c)the
defendant shall deliver the defendant’s reply (if any)
within14 days from the delivery of the
defence.(2)If the third party enters an
appearance, any party (including the thirdparty) may, by
summons to be served on all the other parties to the action,apply
to the Court or a Judge for directions.(3)On
an application for directions under this rule the Court or a
Judgemay—(a)if the liability
of the third party to the defendant who issued thethirdpartynoticeisestablishedonthehearing—ordersuchjudgmentasthenatureofthecasemayrequiretobeenteredagainst the
third party in favour of the defendant; or(b)order any claim, question or issue stated in
the third party noticeto be tried in such manner as the
Court or a Judge may direct; or(c)dismiss the application and terminate the
proceedings on the thirdparty notice;and may do so
either before or after any judgment in the action has beensigned by the plaintiff against the
defendant.(4)On an application for directions under
this rule the Court or a Judgemay give the
third party leave to defend the action, either alone or
jointlywith any defendant, upon such terms as may be
just, or to appear on thetrial and take such part therein as may
be just, and generally may make suchorders and give
such directions as appear to the Court or Judge proper forhaving the rights and liabilities of the
parties most conveniently determinedand enforced and
as to the extent to which the third party is to be bound byany
judgment or decision in the action.(5)Any
order made or direction given under this rule may be varied
orrescinded by the Court or a Judge at any
time.
133Rules of the Supreme Court˙Copies of pleadings5.(1)A
defendant who has brought third party proceedings shall as
soonas possible after the close of pleadings
supply to the plaintiff a copy of allpleadings
(including applications and orders for particulars and
particularsdelivered pursuant thereto) in those
proceedings.(2)Any party shall be entitled on payment
to a copy of any pleadings(including applications and orders for
particulars and particulars deliveredpursuant thereto)
delivered by any other party to the action.˙Default of third party etc.6.(1)Ifathirdpartydoesnotenteranappearanceor,havingbeenordered, or being required by these rules, to
deliver a defence, fails to doso—(a)the third party shall be deemed to
admit any claim stated in thethird party
notice and shall be bound by any judgment (includingjudgment by consent) or decision in the
action in so far as it isrelevant to any claim, question or
issue stated in that notice; and(b)the
defendant by whom the third party notice was issued may, ifjudgment in default is given against him or
her in the action, atany time after satisfaction of that
judgment and, with the leave ofthe Court or a
Judge, before satisfaction thereof, enter judgmentagainst the third party in respect of any
contribution or indemnityclaimed in the notice, and, with the
leave of the Court or a Judge,in respect of
any other relief or remedy claimed therein.(2)If a
third party or the defendant by whom a third party notice
wasissued makes default in delivering any
pleading which the third party ordefendant is
ordered, or required by these rules, to deliver, the Court or
aJudge may, on the application by summons of
that defendant or the thirdparty,asthecasemaybe,ordersuchjudgmenttobeenteredfortheapplicant as the
third party or defendant is entitled to on the pleadings ormaymakesuchotherorderasmayappeartotheCourtoraJudgenecessary to do justice between the
parties.(3)The Court or a Judge may at any time
set aside or vary a judgmententered under
subrule (1)(b) or (2) on such terms (if any) as the Court orJudge
may think just.
134Rules of the Supreme Court˙Setting aside third party
proceedings7.Proceedingsonathirdpartynoticemay,atanystageoftheproceedings, be
set aside by the Court or a Judge.˙Judgment between defendant and third
party8.(1)Where in any
action a defendant has served a third party notice, theCourt
or a Judge may at or after the trial of the action or, if the
action isdecided otherwise than by trial, on an
application by summons or motion,order such
judgment as the nature of the case may require to be entered
forthedefendantagainstthethirdpartyorforthethirdpartyagainstthedefendant.(2)Whereinanactionjudgmentisgivenagainstadefendantandjudgment is given for the defendant against a
third party, execution shall notissue against the
third party without the leave of the Court or a Judge untilthe
judgment against the defendant has been satisfied.˙Claims and issues between a defendant
and some other party9.(1)Where in any
action a defendant who has entered an appearance—(a)claims against a person who is already
a party to the action anycontribution or indemnity; or(b)claims against such a person any
relief or remedy relating to orconnectedwiththeoriginalsubjectmatteroftheactionandsubstantially the same as some relief or
remedy claimed by theplaintiff; or(c)requires that any question or issue relating
to or connected withthe original subject matter of the
action should be determined notonly as between
the plaintiff and himself or herself but also asbetweeneitherorbothofthemandsomeotherpersonwhoisalready a party to the action;then,
subject to subrule (2), the defendant may, without leave, issue
andserveonthatpersonanoticecontainingastatementofthenatureandgrounds of the defendant’s claim or, as the
case may be, of the question orissue required to
be determined.(2)Where a defendant makes such a claim
as is mentioned in subrule (1)
135Rules of the Supreme Courtandthatclaimcouldbemadebythedefendantbycounterclaimintheaction, subrule (1) shall not apply in
relation to the claim.(3)No appearance to
such a notice shall be necessary if the person onwhom
it is served has entered an appearance in the action or is a
plaintifftherein,andthesameprocedureshallbeadoptedforthedeterminationbetween the
defendant by whom, and the person on whom, such a notice isservedoftheclaim,questionorissuestatedinthenoticeaswouldbeappropriate under this order if the person
served with the notice were a thirdparty and (where
the person has entered an appearance in the action or is aplaintiff) had entered an appearance to the
notice.(4)Rule4(1)shallhaveeffectinrelationtoproceedingsonanoticeissued under this
rule as if for the words ‘within 28 days from the timelimited for the third party’s appearance’
there were substituted the words‘within 28 days
after service of the notice on the person’.˙Claims
by third and subsequent parties10.(1)Where a defendant has served a third party
notice and the thirdparty makes such a claim or requirement
as is mentioned in rule 1 or 9, thisorder shall, with
the modification mentioned in subrule (2) and any othernecessary modifications, apply as if the
third party were a defendant; andsimilarly where
any further person to whom by virtue of this rule this orderappliesasifthepersonwereathirdpartymakessuchaclaimorrequirement.(2)The
modification referred to in subrule (1) is that subrule (3)
shallhave effect in relation to the issue of a
notice under rule 1 by a third party insubstitution for
rule 1(2).(3)A third party may not issue a notice
under rule 1 without the leave oftheCourtoraJudgeunlessthethirdpartyissuesthenoticebeforetheexpiration of 14 days after the time
limited for appearing to the notice issuedagainst the third
party.˙Offer of contribution11.If, before the trial of an action, a
party to the action who, either as athird party or as
1 of 2 or more tortfeasors liable in respect of the samedamage, stands to be held liable in the
action to another party to contribute
136Rules of the Supreme Courttowards any debt or damages which may be
recovered against that otherparty in the
action, makes (without prejudice to his or her defence) a
writtenoffer to that other party to contribute to a
specified extent to the debt ordamages, then,
notwithstanding that the party reserves the right to bring
theoffer to the attention of the Judge at the
trial, the offer shall not be brought tothe attention of
the Judge until after all questions of liability and amount
ofdebt or damages have been decided.˙Counterclaim by defendant12.Where in any action a counterclaim is
made by a defendant, rules 1to 11 shall apply
in relation to the counterclaim as if the subject matter of
thecounterclaim were the original subject matter
of the action, and as if theperson making the
counterclaim were the plaintiff and the person againstwhom
it is made a defendant.˙Consolidation13.(1)Notwithstandingtheprovisionsoforder61,rule5,causesormatters in which a plaintiff or a defendant
desires to claim contribution orother relief
under theLaw Reform (Tortfeasors Contribution,
ContributoryNegligence,andDivisionofChattels)Act1952againstaplaintifforadefendant in another cause or matter
may be consolidated by the order ofthe Court or a
Judge upon such terms as may appear to the Court or theJudge
to be just, on the application of any person who is a party to any
ofthe causes or matters.(2)The
application shall be supported by affidavit which shall be
servedon all other parties.˙Costs14.The Court or a
Judge may decide all questions of costs arising asbetween a third or any subsequent party and
the other parties to the action,or as between
codefendants, or as between all parties in causes or mattersconsolidated under this order, and may order
any party or parties to pay thecosts of any
other party or parties, or give such other directions as to
costsas the justice of the case may
require.
137Rules of the Supreme Court†ORDER 18—SUMMARY JUDGMENT IN
ACTIONSWITHIN ORDER 6, RULE 7˙Application for summary judgment1.(1)When a defendant
appears to a writ of summons specially endorsedunder order 6,
rule 7, the plaintiff may, on affidavit made personally or
byany other person, verifying the facts on
which the claim, or the part of aclaim,towhichtheapplicationrelatesisbasedandstatingthatinthedeponent’s belief
there is no defence to that claim or part, as the case maybe,
apply to a Judge for judgment against that defendant.(1A)The Judge may
thereupon, unless the defendant satisfies the Judgewithrespecttotheclaim,orpartoftheclaim,towhichtheapplicationrelates that
there is a question in dispute which ought to be tried or that
thereought for some other reason to be a trial of
that claim or part, give suchjudgment for the
plaintiff against that defendant on that claim or part as
maybe just having regard to the nature of the
remedy or relief claimed.(2)The Judge may by
order, and subject to such conditions (if any) asmay
be just, stay the execution of any judgment given against a
defendantunder this rule until after the trial of any
counterclaim made or raised by thedefendant in the
action.(3)Where the plaintiff obtains judgment
on a claim or part of a claimagainst any
defendant, the plaintiff may proceed with the action as
respectsany other claim or as respects the remainder
of the claim or against anyother
defendant.(4)Any defect in the special endorsement
may be amended forthwithupon such terms as the Judge may think
just.(5)When an application has been dismissed
on the ground of formaldefects in the proceedings or in the
evidence, a fresh application may bemade on amended
proceedings.˙Manner in which application to be
made2.(1)An application
by a plaintiff for judgment under rule 1 shall bemade
by summons.(2)Unless the Judge otherwise directs, an
affidavit for the purposes of
138Rules of the Supreme Courtthe
application may contain statements of information or belief with
thesources and grounds thereof.(3)The summons, a copy of any affidavit
in support and of any exhibitreferred to
therein shall be served on the defendant not less than 4 clear
daysbefore the return day.(4)The
Judge may on such terms as may be just permit further
evidenceby affidavit or otherwise to be given on
behalf of the plaintiff on the hearingof the
application.˙Defendant may show cause3.(1)Thedefendantmayshowcauseagainstsuchapplicationbyaffidavit, or by leave of the Judge by oral
evidence, or otherwise to thesatisfaction of
the Judge.(2)If the defendant shows cause by
affidavit, the affidavit shall statewhether the
defence alleged goes to the whole or to part only, and if so
whatpart of the plaintiff’s claim.(3)Unless the Judge otherwise directs an
affidavit for the purposes ofthis rule may
contain statements of information or belief with the sourcesand
grounds thereof.(4)The Judge may, if the Judge thinks
fit, order the defendant or, in thecase of a
corporation, any officer thereof, to attend and be examined
uponoath, or to produce any leases, deeds, books,
or documents, or copies of orextracts
therefrom.˙Judgment for part of claim4.(1)If it appears
that the defence set up by the defendant applies only toa
part of the plaintiff’s claim, or that any part of the plaintiff’s
claim isadmitted, the plaintiff shall have judgment
forthwith for that part of theplaintiff’s claim
to which the defence does not apply, or which is admitted,subject to such terms (if any) as to
suspending execution, or the payment ofthe amount
levied, or any part thereof, into court by the sheriff, the
taxationof costs, or otherwise, as the Judge may
think fit.(2)And the defendant may be allowed to
defend as to the residue of theplaintiff’s
claim.
139Rules of the Supreme Court˙Where 1 defendant has good defence, but
other not5.If it appears to the Judge that any
defendant has a good defence to theaction, or ought
to be permitted to defend, and that any other defendant hasnot
such defence and ought not to be permitted to defend, the former
maybe permitted to defend; and the plaintiff
shall be entitled to judgment againstthe latter, and
may issue execution upon such judgment without prejudice tothe
plaintiff’s right to proceed with the action against the
former.˙Leave to defend6.Leave to defend may be given unconditionally
or subject to such termsas to giving security, or as to the
time or mode of trial, or otherwise, as theJudge may think
fit.˙Summary disposal7.On
the hearing of the application, the Judge may, with the consent
ofall parties, dispose of the action in a
summary manner.˙Directions as to trial8.When leave, whether conditional or
unconditional, is given to defend,theJudgeshallhavepowertogiveallsuchdirectionsastothefurtherconduct of the action as might be given on a
summons for directions underorder 20, and may
order the action to be forthwith set down for trial.˙Costs9.(1)If
the plaintiff makes an application under rule 1 where the case
isnot within this order, or if it appears to
the Judge that the plaintiff knew thatthe defendant
relied on a contention which would entitle the defendant tounconditional leave to defend, then, without
prejudice to any other power ordiscretion of the
Court or a judge, the Judge may dismiss the applicationwith
costs and may require the costs to be paid by the plaintiff
forthwith.(2)Where no order is made as to the costs
of the application, or when thecosts are
referred to the Judge at the trial, and no trial afterwards takes
place,
140Rules of the Supreme Courtor no
order as to costs is made at the trial, the costs of the
application shallbe costs in the action.˙Relief
from forfeiture10.A tenant shall have the same right of
relief after a judgment underthis order for
recovery of land on the ground of forfeiture for non-paymentof
rent as if the judgment had been given after trial.˙Judgment for delivery up of
chattel10A.Where the claim
to which an application under rule 1 relates is forthe
delivery up of a specific chattel and the Judge gives judgment
under thatrule for the applicant, the Judge may order
the defendant to deliver up thechattel without
giving the defendant the option to retain it on paying itsassessed value.˙Setting aside judgment10B.Any
judgment given against a defendant who does not appear at
thehearing of an application under rule 1 may be
set aside or varied by theCourt or a Judge on such terms as the
Court or Judge may think just.˙If
writ issues from district registry11.IfthewritofsummonsisnotissuedatBrisbane,Rockhampton,Townsville or
Cairns, the following rules apply—(a)thesummonsforfinaljudgmentmaybemadereturnableatafollowing place—(i)the
place where it was issued (“issuing place”);(ii)if the issuing
place is in the central district—Rockhampton;(iii)if
the issuing place is in the northern district—Townsville;(iv)if the issuing
place is in the far northern district—Cairns;(v)iftheissuingplaceisnotinthecentral,northernorfar
141Rules of the Supreme Courtnorthern district—Brisbane.1(b)asummonsmadereturnableattheplacefromwhichitwasissued shall be heard and determined
by a Judge at that place,unless a Judge otherwise
orders;(c)if on the return day no Judge is
present at the place at which thesummonsismadereturnable,theregistrarshallforthwithtransmitthesummonsandotherdocumentsintheregistrar’spossession
relating to the summons, to the registrar of the Courtat
Brisbane, Rockhampton, Townsville or Cairns, as the case maybe;(d)onthefirstdayafterthereceiptofthesummonsandotherdocumentsonwhichaJudgeisappointedtositinchambers,such
registrar shall submit the same to such Judge for hearingand
determination; if the Judge is not present, the registrar
shalladjourn the matter;(e)whenthesummonsismadereturnableatBrisbane,Rockhampton,
Townsville or Cairns, the registrar of the registryatwhichthesummonswasissuedshallforthwithtransmitacertified copy of the writ and of the
summons, together with theaffidavits and other documents
relating thereto, to the registrar ofthe Court at
Brisbane, Rockhampton, or Townsville, as the casemay
be;(f)the minute of the order of the Judge,
together with the summonsandotherdocumentsrelatingtoit,shallbereturnedbytheregistrar to the registrar at the
place from which the summonswas
issued.1Fortheboundariesofthecentral,northernandfarnortherndistricts,seetheSupreme Court Act 1995, section 266A
and schedules 1 to 3.
142Rules of the Supreme Court†ORDER 18A—SUMMARY JUDGMENT IN
ACTIONSFOR SPECIFIC PERFORMANCE ETC.˙Application by plaintiff for summary
judgment1.Wherethedefendanthasappearedtoawritofsummonsendorsedwith
a claim—(a)for specific performance of an
agreement (whether in writing ornot) for the
sale, purchase, exchange, lease or transfer of property,with
or without an alternative claim for damages; or(b)for
rescission of such an agreement; or(c)for
the forfeiture or return of any deposit made under such anagreement;the plaintiff
may, on the ground that the defendant has no defence to theaction, apply to a Judge for judgment.˙Manner in which application must be
made2.(1)An application
under rule 1 shall be made by summons supportedby an affidavit
made by some person who can swear positively to the factsverifying the cause of action and stating
that in the person’s belief there isno defence to the
action.(2)The summons shall set out or have
attached thereto minutes of thejudgment sought
by the plaintiff.(3)The summons, a copy of any affidavit
in support and of any exhibitreferred to
therein shall be served on the defendant not less than 4 clear
daysbefore the return day.(4)The
Judge may on such terms as may be just permit further
evidenceby affidavit or otherwise to be given on
behalf of the plaintiff on the hearingof the
application.˙Judgment for plaintiff3.Unless on the hearing of an
application under rule 1 either the Judgedismisses the
application or the defendant satisfies the Judge that there is
an
143Rules of the Supreme Courtissue
or question in dispute which ought to be tried or that there ought
forsome other reason to be a trial of the action
the Judge may give judgmentfor the plaintiff
in the action.˙Leave to defend4.(1)A
defendant may show cause against an application under rule 1
byaffidavit or otherwise to the satisfaction of
the Judge.(2)The Judge may give a defendant against
whom such an application ismade leave to
defend the action either unconditionally or on such terms asto
giving security or time or mode of trial or otherwise as the Judge
thinksfit.(3)OnthehearingofsuchanapplicationtheJudgemayorderadefendant showing cause or, where that
defendant is a body corporate, anydirector,
manager, secretary or other similar officer thereof, or any
personpurporting to act in any such
capacity—(a)to produce any document;(b)ifitappearstotheJudgethattherearespecialcircumstanceswhich make it
desirable that the defendant should do so, to attendand
be examined on oath.˙Directions5.WheretheJudgeordersthatadefendanthaveleavetodefendtheaction,theJudgeshallhavepowertogiveallsuchdirectionsastothefurther conduct
of the action as might be given on a summons for directionsunder
order 20, and may order the action to be set down for trial.˙Costs6.If
the plaintiff makes an application under rule 1 where the case is
notwithin this order, or if it appears to the
Judge that the plaintiff knew that thedefendantreliedonaconditionwhichwouldentitlethedefendanttounconditional leave to defend, then, without
prejudice to any other power ordiscretion of the
Court or a Judge, the Judge may dismiss the applicationwith
costs and may require the costs to be paid by the plaintiff
forthwith.
144Rules of the Supreme Court˙Setting aside judgment7.Any judgment given against a defendant
who does not appear at thehearing of an application under rule 1
may be set aside or varied by theCourt or a Judge
on such terms as the Court or Judge may think just.†ORDER 19—SUMMARY JUDGMENT†1. Actions for account˙Order for account1.Whenawritofsummonshasbeenendorsedwithaclaimforanaccountunderorder6,rule9,orwhentheclaimendorsedonawritofsummons involves taking an account, the
plaintiff may at any time afterappearance, or
after the time for entering an appearance has expired, applyto a
Judge for an order to take the account.˙Application, how made2.(1)Anapplicationforanorderunderrule1shallbemadebysummons, and shall, when necessary, be
supported by affidavits, statingconcisely the
grounds of the plaintiff’s claim to an account.(2)If
any defendant has made default in appearance, the application
may,as against the defendant, be made ex
parte.˙Evidence in answer3.If
the defendant does not, by affidavit or otherwise, satisfy the
Judgethat there is some preliminary question to be
tried, an order for the properaccounts, and for
all necessary inquiries, with such directions as are usual
insimilar cases, shall be made
forthwith.
145Rules of the Supreme Court†2. Actions for administration,
declaration of right, foreclosure,redemption
etc.˙Judgment without pleadings4.In any action in which an account has
been taken under rules 1 to 3,the plaintiff
may, at any time after the account has been taken, and in
anyaction for administration of real or personal
estate, or for the execution of atrust, and in any
action for limited relief under the provisions of order 4,rule
12 or 16 in which the writ of summons has been specially
endorsedunder order 6, rule 10, and in any action in
which the writ has been speciallyendorsed under
the provisions of order 6, rule 11, the plaintiff may at anytime
after appearance, or after the time for appearance has expired,
apply tothe Court for judgment in a summary way
without pleadings, and the Courtshallthereuponproceedtohearanddeterminetheactionandgivesuchjudgment as may be just.˙Evidence5.The
motion shall be heard upon affidavit unless the Court
otherwisedirects, and the Court may give such
directions as it thinks just for the trialof any questions
arising thereon.˙Action may be directed to proceed in
usual course6.Onanapplicationforsummaryjudgmentundertheprovisionsofrules
4 and 5 the Court may refuse to give judgment on the motion,
andmay direct the action to proceed in the usual
manner.†ORDER 20—SUMMONS FOR DIRECTIONS˙Summons for directions1.(1)A party to an
action may take out a summons for directions at anytime
before judgment.
146Rules of the Supreme Court(2)Asummonsfordirectionsshallnotbetakenoutbyoragainstadefendant until that defendant has entered an
appearance.˙Interlocutory proceedings2.(1)Upon the hearing
of the summons, the Court or a Judge or registrarmay
give such directions with respect to the proceedings as the Court
orJudge or registrar thinks proper.(2)Withoutprejudicetothegeneralityofsubrule(1),theCourtoraJudge or registrar may—(a)make such order as is just with
respect to—(i)discovery and inspection of documents;
and(ii)interrogatories;
and(iii)inspections of
real or personal property; and(iv)admissions of fact or of documents;
and(v)the place, time and mode of trial;
and(b)order that evidence of a particular
fact or facts, to be specified inthe order, shall
be given at the hearing or trial—(i)by
statement on oath of information and belief;(ii)by
production of documents or entries in books;(iii)by
copies of documents or entries;(iv)otherwise as the Court or Judge or registrar
directs; and(c)order the action to be set down for
trial forthwith and settle theissues to be
tried; and(d)makesuchorderasisjustwithrespecttopleadingsandparticulars; and(e)where 2 or more tortfeasors are sued
together in respect of thesametortordamageand1oftheminthesameproceedingsclaims
contribution from the other or others—order that a writtenoffer of contribution made by 1 of those
tortfeasors to the other orothers of them
shall be treated for the purposes of that claim as anotice of payment into court;
and
147Rules of the Supreme Court(f)may revoke or vary an order made under
this subrule.(3)A registrar may refer any such summons
to a Judge.˙No affidavit to be used without
leave3.Anaffidavitshallnotbeusedatthehearingofasummonsfordirections except by leave of the Court or a
Judge or registrar.˙Parties to apply for directions4.Onthehearingofthesummons,apartytowhomthesummonsisaddressed, shall so far as practicable, apply
for any interlocutory order ordirections.˙Subsequent applications5.An
application by a party subsequent to the original summons
andbefore judgment for directions as to an
interlocutory matter or thing shall bemade under the
summons by 2 clear days notice to the other party statingthe
grounds of the application.˙Cost
of subsequent application6.An application
by a party which might have been made at the hearingof
the original summons shall, if granted on a subsequent application,
begranted at the cost of the party applying
unless the Court or a Judge orregistrar is of
opinion that the application could not properly and
reasonablyhave been made at the hearing of the original
summons.˙Applications for judgment7.Any application for judgment under
order 18 or 18A, or in an action inwhichtheonlyreliefclaimedisamandamusorinjunction,andanyapplication for a certificate or order
that an action should be tried speedily,may be treated as
a summons for directions.
148Rules of the Supreme Court˙Adjournment8.The
further hearing of the summons shall be adjourned from time
totime until the conclusion of the
action.†ORDER 22—PLEADING GENERALLY˙Pleading to state material facts and
not evidence—costs of prolixpleadings1.(1)Every pleading
shall contain a statement, as brief as the nature ofthe
case will allow, setting out the material facts on which the party
pleadingrelies to support the party’s claim or
defence, as the case may be, but not theevidence by which
they are to be proved; and shall, when necessary, bedivided into paragraphs, numbered
consecutively, and each containing, asnearly as may be,
a separate allegation.(2)Dates, sums, and
numbers may be expressed in figures or in words.(3)Signature of counsel shall not be
necessary.(4)Every pleading shall be signed by the
solicitor of the party, or by theparty personally,
if the party sues or defends in person.(5)The
Court or a Judge in adjudging the costs of the action or the
taxingofficer in adjusting the costs of the action
shall at the instance of any party,and may without
any request, inquire into any unnecessary prolixity, andmay
order the costs occasioned by such prolixity to be borne by the
partyresponsible for the same.˙Delivery of pleadings2.(1)The
plaintiff shall, subject to the provisions of order 24, and at
suchtime and in such manner as therein
prescribed, deliver to the defendant astatement of the
plaintiff’s claim, and of the relief or remedy to which theplaintiff claims to be entitled.(2)The defendant shall, subject to the
provisions of order 25, and at suchtime and in such
manner as therein prescribed, deliver to the plaintiff
the
149Rules of the Supreme Courtdefendant’s defence, set-off, or counterclaim
(if any), and the plaintiff shall,subject to the
provisions of order 27, and at such time and in such manneras
therein prescribed, deliver the plaintiff’s reply (if any) to such
defence,set-off, or counterclaim.˙Set-off and counterclaim3.(1)Adefendantmaypleadbywayofset-off,orset-upbywayofcounterclaim,
against the claim of the plaintiff, or any of the plaintiffs,
ifmore than 1, any right or claim, whether such
set-off or counterclaim soundin damages or
not; and such set-off or counterclaim shall have the sameeffectasacrossaction,soastoenabletheCourttopronounceafinaljudgment in the
same action, both on the original claim and on the crossclaim.(2)But
the Court or a Judge may strike out a defence by way of
set-offor a counterclaim, if in the opinion of the
Court or Judge such set-off orcounterclaim
cannot be conveniently disposed of in the pending action, orought
not to be allowed, or may order that it shall be disposed of
separately.˙Relief founded on separate facts4.(1)When the
plaintiff seeks relief in respect of several distinct claimsor
causes of complaint founded upon separate and distinct grounds,
theyshall be stated, as far as may be, separately
and distinctly.(2)And the same rule shall apply where a
defendant relies upon severaldistinctgroundsofdefenceorcounterclaimfoundeduponseparateanddistinct facts.˙Particulars to be given in certain
cases6.(1)If the party
pleading relies on any misrepresentation, fraud, breachof
trust, wilful default, or undue influence, and in all other cases
in whichparticulars may be necessary, particulars,
with dates and items if necessary,shall be stated
in the pleading.(2)However, if the particulars are of
debt, expenses, or damages, andexceed 3 folios,
the fact shall be so stated, with a reference to full
particularsalready delivered or to be delivered with the
pleading.
150Rules of the Supreme Court˙Printing pleadings7.Pleadings may be either printed or written,
or partly printed and partlywritten.˙Pleadings how delivered—delivery by
filing—service at documentexchange8.(1)Everypleadingorotherdocumentrequiredtobedeliveredtoaparty, or between parties, shall be
delivered at the address for service, to thesolicitor of
every party who sues or appears by a solicitor, or to the party
ifthe party does not sue or appear by a
solicitor; but if no appearance has beenentered for any
party, then such pleading or document shall be delivered bybeing
filed in the registry.(2)Where a
solicitor representing a party has facilities for the
receptionofdocumentsinadocumentexchange,deliveryofapleadingorotherdocument into
those facilities shall be deemed to be sufficient delivery to
orservice on that solicitor.(3)Delivery to or service on a solicitor
of a pleading or other documentshallbedeemedtobeeffectedonthedayafterwhichthedocumentisdelivered into the facilities of the document
exchange.(4)In this rule—“document
exchange”means the Australian Document Exchange or
anyother document exchange for the time being
approved by the ChiefJustice.˙Marking pleadings9.Every pleading shall be marked on the face
with the number of theaction, the title of the action, the
date of the day on which the pleading isdelivered, and
the description of the pleading, and shall be endorsed with
thename and address for service of the solicitor
and agent (if any) deliveringthe same, or the
name and address for service of the party delivering thesame
if the party does not sue or appear by a solicitor.
151Rules of the Supreme Court˙Pleadings settled by counsel9A.Where a pleading is settled by
counsel, the name of the counsel shallbe written on the
pleading.˙Plea of ‘not guilty by statute’ not to
be used10.The defence of ‘not guilty by statute’
shall not be used.˙Specific denial11.Every allegation of fact in any statement of
claim or counterclaim, ifnotdeniedspecificallyorbynecessaryimplicationorstatedtobenotadmitted in the
pleading of the opposite party, shall be taken to be
admitted,except as against an infant or a mentally ill
person.˙Conditions precedent to be specified by
party denying performance12.(1)An averment of
the performance or occurrence of all conditionsprecedentnecessaryforthecaseofeitherpartyshallbeimpliedintheparty’s pleading.(2)And
when the performance or occurrence of any condition
precedentis denied, the condition must, unless it
already appears by implication, bedistinctly
specified in his or her pleading by the party denying it.˙Particulars of failure to perform a
contract to be specified by partyalleging
failure12A.A party
intending to rely on the failure of a person to be or to
havebeen ready, willing and able to perform a
contract must—(a)allege the failure as a fact;
and(b)give particulars of the
failure;in the party’s pleading.˙Several defences or answers13.Anypartymay,withoutleave,pleadanynumberofseparate
152Rules of the Supreme Courtdefences or other replies or answers to the
previous pleading of the oppositeparty.˙Pleadings to raise all grounds of
defence or reply14.Eachpartymustraisebytheparty’spleadingallmattersoffactwhich show that
the claim of the opposite party is not maintainable, or that
atransaction is either void or voidable in
point of law; and all grounds ofdefence or reply,
as the case may be, must be pleaded which, if not raised,would
be likely to take the opposite party by surprise, or would raise
issuesof fact not arising out of the preceding
pleadings, as, for instance, fraud,release, payment,
performance, facts showing illegality either by statute orcommon law, or theStatute of
Frauds and Limitations 1867, or any
otherstatute of limitations.˙Departure15.A
pleading shall not raise any new ground of claim, or contain
anyallegationoffact,inconsistentwiththepreviouspleadingsofthepartypleading the same.˙General denial16.It
is sufficient for a defendant in the defendant’s statement of
defencetodenygenerallyanyallegationsinthestatementofclaim,andforaplaintiff in his
or her answer to deny generally any allegations in a defenceby
way of counterclaim.˙Confession and
avoidance17.When a party admits any allegation in
the pleading of the oppositeparty, and sets
up other matter in answer thereto, the party must, unless
theparty amends his or her pleading, plead such
other matter specifically in afurther
pleading.˙Joinder of issue18.(1)Either party may, in any pleading subsequent
to defence or answer
153Rules of the Supreme Courtto
counterclaim, join issue upon the last preceding pleading of the
oppositeparty.(2)Suchjoinderofissueshalloperateasadenialofeverymaterialallegation of fact in the pleading upon which
issue is joined, but it mayexcept any facts
which the party may be willing to admit, and shall thenoperate as a denial of the facts not so
admitted.˙Effect of general denial19.Subject to rule 20 and to order 25, a
general denial of an allegation offact in a
previous pleading shall be construed as a denial of the
allegation,and of all the alleged circumstances, whether
of time, place, amount, orotherwise.˙Effect
of denial of contract20.When a contract,
promise, or agreement, is alleged in any pleading, abare
denial of the same by the opposite party shall be construed only as
adenial in fact of the express contract,
promise, or agreement, alleged, or ofthe matters of
fact from which the same may be implied by law, and not asa
denial of the legality or sufficiency in law of such contract,
promise, oragreement, whether with reference to
theStatute of Frauds and Limitations1867, or theSale of Goods
Act 1896, or otherwise, or of the authority
ofany person by whom the contract, promise, or
agreement, is alleged to havebeen entered
into.˙Effect of documents to be stated21.When the contents of a document are
material, it is sufficient to statethe effect
thereof as briefly as possible, without setting out the whole or
anypart thereof, unless the precise words of the
document or any part thereofare
material.˙Malice, knowledge etc.22.When it is material to allege malice,
fraudulent intention, knowledge,or other
condition of the mind of any person, it is sufficient to allege
the
154Rules of the Supreme Courtsame
as a fact without setting out the circumstances from which it is to
beinferred.˙Notice23.When
it is material to allege notice to any person of any fact,
matter,or thing, it is sufficient to allege such
notice as a fact, unless the form or theprecise terms of
such notice, or the circumstances from which such noticeis to
be inferred, are material.˙Implied contract
or relation24.(1)When any
contract or any relation between any persons is to beimpliedfromaseriesoflettersorconversations,orotherwisefromanumber of circumstances, it is
sufficient to allege such contract or relationasafact,andtorefergenerallytosuchletters,conversations,orcircumstances, without setting them out in
detail.(2)Andifinsuchcasethepersonsopleadingdesirestorelyinthealternative upon more contracts or
relations than one as to be implied fromsuch
circumstances, the person may state the same in the
alternative.˙Stated or settled account to be
alleged25.When the cause of action is a stated
or settled account, the same mustbe alleged with
sufficient particulars, but when a statement of account isrelied on by way of evidence or admission of
some other cause of actionwhich is pleaded, the same shall not be
alleged in the pleadings.˙Presumptions of
law26.A party need not in any pleading
allege any matter of fact which thelaw presumes in
the party’s favour, or as to which the burden of proof doesnot
lie upon the party, unless the same has first been specifically
denied bythe other party: for example, the
consideration for a bill of exchange whentheplaintiffsuesonlyonthebill,andnotfortheconsiderationasasubstantive ground of
claim.
155Rules of the Supreme Court˙Points of law may be raised by
pleadings27.(1)Any party may
raise by the party’s pleading any point of law, andany
point so raised shall, if not previously disposed of, be disposed
of bythe Judge who tries the action, at or after
the trial.(2)However, by consent of the parties, or
by order of the Court or aJudge, made on the application of
either party, the same may be set downfor hearing and
disposed of at any time before the trial.˙Dismissal of action28.If,
in the opinion of the Court or Judge, the decision of such point
oflaw substantially disposes of the whole
action, or of any distinct cause ofaction,claimofdamages,groundofdefence,set-off,counterclaim,oranswer, therein, the Court or Judge may
thereupon dismiss the action orgive or make such
other judgment or order therein as may be just.˙Technical objection29.No
technical objection shall be made to any pleading on the
groundof any alleged want of form.˙When judgment pleaded30.(1)Whenajudgmentispleaded,thepartypleadingmust,within4
days after demand by the opposite party, deliver to the opposite
party acopy of the judgment, certified by the proper
officer of the court by whichthe judgment was
given.(2)Indefaultofsuchdelivery,theCourtoraJudgemayorderthepleading to be struck out or amended.˙Striking out pleading where no
reasonable cause of action or defencedisclosed31.The Court or a Judge may order any
pleading to be struck out, on theground that it
discloses no reasonable cause of action or ground of
defence,or that it shows that the action or defence
is frivolous or vexatious; and inany such case the
Court or a Judge may order that the action be stayed
or
156Rules of the Supreme Courtdismissed, or that judgment be entered as in
default of pleading, as may bejust.˙Striking out pleadings in other
cases32.The Court or a Judge may at any stage
of the proceedings order to bestruck out or
amended any matter in any pleading which is unnecessary orscandalous, or which tends to prejudice,
embarrass, or delay, the fair trial ofthe action; and
may in any such case order the costs of the application to
bepaid as between solicitor and client.˙Notice to plead or set down
demurrer33.(1)Uponeverypleading,exceptajoinderofissueorademurrer,there shall be
endorsed a notice in the form in schedule 1, requiring theoppositepartytodeliverhisorherpleadinginreplytheretowithintheprescribed time.(2)Upon
every demurrer there shall be endorsed a notice in the form
inschedule1,requiringthepartywhosepleadingisdemurredtosetthedemurrer down
within 10 days for argument.†ORDER 23—PARTICULARS˙Order
for particulars1.The Court or a Judge may in any case
order either party to deliver tothe other a
further and better statement of the nature of the claim or
defence,or further and better particulars of any
matter stated in any pleading, notice,or written
proceeding, upon such terms, as to costs and otherwise, as
maybe just.˙Effect
of order for particulars2.(1)The party at
whose instance particulars have been delivered under aJudge’sordershall,unlesstheorderotherwiseprovides,havethesame
157Rules of the Supreme Courtlength of time for taking any step in the
action after the delivery of theparticulars that
he or she had at the return of the summons.(2)Save
as in this rule provided, an order for particulars shall not,
unlessthe order otherwise provides, operate to stay
proceedings, or to give anyextension of
time.˙Affidavit of scripts in probate
actions3.(1)Inprobateactionstheplaintiffanddefendantshallrespectively,within 8 days
after the entry of appearance by the defendant, file an
affidavitspecifyingeverywill,codicil,draftofawillorcodicil,orwritteninstructionsforthesame,madebyorunderdirectionofthetestatororintestate,ofwhichthedeponentorthedeponent’ssolicitorhasanyknowledge, and
stating whether he or she has or has not any such documentin
his or her possession; and every such document which is in his or
hercustody or under his or her control shall be
exhibited to the affidavit andfiled with
it.(2)Except by leave of the Court or a
Judge, a party to the action shallnot, nor shall
the party’s solicitor, be at liberty to inspect the affidavit
filedby any other party, or the documents
exhibited to it, until the party’s ownaffidavit has
been filed.˙Actions for damage by
collision—preliminary acts to be filed4.(1)Inactionsfordamagebycollisionbetweenvessels,unlesstheCourt or a Judge otherwise orders, the
plaintiff or the plaintiff’s solicitorshall,within7daysafterthecommencementoftheaction,andthedefendant or the defendant’s solicitor
shall, within 7 days after appearance,andbeforeanypleadingisdelivered,fileintheregistryadocument(a“preliminary act”), which shall
be sealed up, and shall not be opened untilordered by the
Court or a Judge, and which shall contain a statement of thefollowing particulars—(a)thenamesofthevesselswhichcameintocollision,andthenames of their masters;(b)the time of the collision;(c)the place of the
collision;
158Rules of the Supreme Court(d)the direction and force of the
wind;(e)the state of the weather;(f)the state and force of the
tide;(g)the course and speed of the vessel
when the other was first seen;(h)the
lights (if any) carried by the vessel;(i)the
distance and bearing of the other vessel when first seen;(k)the lights (if any) of the other
vessel which were first seen;(l)whether any lights of the other vessel,
other than those first seen,came into view
before the collision;(m)what measures
were taken, and when, to avoid the collision;(n)the
parts of each vessel which first came into contact;(o)what sound signals (if any) were
given, and when;(p)what sound signals (if any) were heard
from the other vessel, andwhen.(2)The
Court or a Judge may, on the application of either party, order
thepreliminaryactstobeopenedatanytimeandtheevidencetobetakenthereon without its being necessary to
deliver any pleadings; but in suchcase, if either
party intends to rely on the defence of compulsory pilotage,the
party may do so, upon giving notice thereof in writing to the other
party,within2daysfromtheopeningofthepreliminaryactsorwithinsuchfurther time as the Court or a Judge may
allow.˙Opening acts5.The
preliminary acts may be opened as soon as the action has been
setdown for trial.
159Rules of the Supreme Court†ORDER 24—STATEMENT OF CLAIM˙Claim beyond endorsement1.When a statement of claim is
delivered, the plaintiff may therein alter,modify,orextend,theplaintiff’sclaimagainstanydefendantwhohasappeared, without any amendment of the
endorsement of the writ.˙Relief claimed to
be specifically stated3.(1)Every statement
of claim shall state specifically the relief which theplaintiffclaims,whethersinglyorinthealternative,anditshallnotbenecessary to ask for general or other
relief, which may always be given, asthe Court or a
Judge may think just, to the same extent as if it had beenasked
for.(2)And the same rule shall apply to any
counterclaim made or reliefclaimed by the
defendant in his or her defence.˙Probate actions4.Inprobateactions,whentheplaintiffdisputestheinterestofthedefendant, the plaintiff must allege in
his or her statement of claim that theplaintiff denies
the defendant’s interest.˙Statement of
claim5.Subjecttotheprovisionsoforder15,rule13,thedeliveryofstatements of claim shall be regulated as
follows—(a)whenthewritisspeciallyendorsedunderorder6,rule7—nofurther statement of claim shall be
delivered, except as requiredby order 6, rule
12, and the endorsement on the writ be deemed tobe
the statement of claim;(b)when the
plaintiff has, within 28 days after appearance, appliedfor
judgment under order 18, order 18A or order 19, rule 4, or
foranorderunderorder19,rule1,orforreliefunderorder57,rule2—astatementofclaimshallnotbedeliveredunlesstheCourt or a Judge or registrar so
orders;
160Rules of the Supreme Court(c)in all other cases—the statement of
claim shall be delivered withthe writ or
notice of the writ or within 28 days after appearance orwithin such other time as the Court or a
Judge or registrar shallorder.˙Probate actions6.In
probate actions the plaintiff shall, unless otherwise ordered by
theCourt or a Judge, deliver the plaintiff’s
statement of claim within 6 weeksfrom the entry of
appearance by the defendant, or from the time limited forthe
defendant’s appearance, in case the defendant has made default;
butwhen the defendant has appeared the plaintiff
shall not be required to deliverit until the
expiration of 8 days after the defendant has filed the
defendant’saffidavit as to scripts.˙Admiralty actions7.Inadmiraltyactionsinrem,theplaintiffshall,unlessotherwiseordered by the Court or a Judge, deliver the
plaintiff’s statement of claimwithin 12 days
from the entry of appearance by the defendant.˙Actions in which an insurer must be
served8.Where a plaintiff is required by any
Act or statutory instrument toserveacopyofthewritontheStateGovernmentInsuranceOffice(Queensland) or
any other insurer, and to file an affidavit as to such
servicebefore taking any other step in the action,
the plaintiff must allege in thestatement of
claim that the plaintiff has served the writ and filed the
affidavitaccordingly.†ORDER 25—DEFENCE AND COUNTERCLAIM˙Mere denial insufficient1.In actions for a debt or liquidated
demand in money, a mere denial ofthe debt is not
sufficient.
161Rules of the Supreme Court˙Defence to action on bills etc.2.Inactionsuponbillsofexchange,promissorynotes,orcheques,adefence in denial must deny some matter of
fact; for example, the drawing,making,
endorsing, accepting, presenting, or notice of dishonour, of the
billor note.˙Defences to action for debt or liquidated
demand3.In actions to recover a debt or
liquidated demand under a contract, adefence in denial
must deny any matters of fact from which the liability ofthe
defendant is alleged to arise which are disputed; for example, in
actionsfor goods bargained and sold or for goods
sold and delivered, the defencemust deny the
order or contract, the delivery, or the amount claimed; in
anaction for money received to the use of the
plaintiff, it must deny the receiptof the money, or
the existence of those facts which are alleged to make suchreceipt by the defendant a receipt to the use
of the plaintiff.˙Pleading to damages4.A
denial or defence shall not be necessary as to damages claimed
ortheir amount: but the damages shall be deemed
to be put in issue in allcases, unless expressly
admitted.˙Denial of right of person in
representative capacity5.If any party
desires to put in issue the right of any other party to
claimasexecutororadministrator,orastrustee,whetherininsolvencyorotherwise, or in any representative or other
alleged capacity, or to put inissue the alleged
constitution of any partnership firm, the party must do sospecifically.˙Time
for delivery of defence6.Subject to rule
7, when a defendant has entered an appearance thedefendant shall deliver his or her defence
including his or her counterclaim(if any) within
28 days from the time limited for appearance or from thedelivery of the statement of claim, whichever
is the later, or within suchother time as the
Court or a Judge or registrar shall order.
162Rules of the Supreme Court˙Delivery of defence to a specially
endorsed writ7.(1)Where a
defendant has appeared to a writ of summons speciallyendorsed under order 6, rule 7, the defendant
shall deliver his or her defencewithin 10 days
from the time limited for appearance, unless such time isextended by the Court or Judge, or unless in
the meantime plaintiff serves asummons for
judgment under order 18.(2)However,whereaspecialendorsementisjoinedwithanendorsement not special, the defendant
shall not be required to deliver his orher defence to
the claims specially endorsed before delivering his or herdefence to the statement of claim delivered
in respect of such claims as arenot specially
endorsed.˙Where leave to defend given8.When leave has been given to a
defendant to defend under order 18,thedefendantmustdeliverhisorherdefence(ifany)withintheperiodlimited by the
order giving the defendant leave to defend; or if no period
isthereby limited, then within 28 days after
the order.˙Admissions9.When
the Court or a Judge is of opinion that any allegation of
factdenied or not admitted by the defence ought
to have been admitted, theCourt or Judge may make such order as
may be just with respect to anyextra costs
occasioned by such denial or failure to admit.˙Defence of tender9A.Where in any action a defence of tender
before action is pleaded, thedefendantmustpayintoCourtinaccordancewithorder46theamountalleged to have
been tendered, and the tender shall not be available as adefence unless and until payment into court
has been made.˙Counterclaim10.When
a defendant relies upon any facts or circumstances alleged
inthe pleadings as establishing a right of
counterclaim, the defendant must, in
163Rules of the Supreme Courthis
or her defence, state specifically that the defendant relies on
them byway of counterclaim.˙Title
of counterclaim11.When a defendant sets up any
counterclaim which raises questionsbetween himself
or herself and the plaintiff together with any other person,the
defendant must add to the title of his or her defence a further
title similarto the title in a statement of claim, setting
forth as defendants the names ofallthepersonswho,ifsuchcounterclaimweretobeenforcedbycrossaction, would be
defendants to such cross action, and must deliver his orhercounterclaimtosuchofthemasarepartiestotheactionwithintheperiod within which the defendant is
required to deliver it to the plaintiff.˙Claim
against person not party12.When any such
person as in rule 11 mentioned is not a party to theaction, the person shall be summoned to
appear in the action by personalservice upon the
person of a copy of the counterclaim endorsed in the formin
schedule 1, or to the like effect.˙Appearance by third parties13.Any person, not being a party to the
action, who is served with acounterclaim as
aforesaid must appear thereto as if the person had beenserved with a writ of summons to appear in an
action, and, in default ofappearance,thedefendantcounterclaimingagainstthepersonmayuponfiling a proper
affidavit of service proceed with the counterclaim as
againstthe other defendants to the counterclaim as
if such person had appeared, andmay proceed
against the party so making default in the same manner, andsubjecttothesameconditions,asifthecounterclaimwereawritofsummons.˙Answer
to counterclaim14.(1)Anypersonnamedinadefenceasapartytoacounterclaimthereby made
must, if the person is party to the action, deliver his or
heranswer to the counterclaim within 14 days or
such other time as the Court
164Rules of the Supreme Courtor a
Judge or registrar shall order.(2)If
the person is not a party to the action, the person must deliver
hisor her answer to the counterclaim within 28
days after the time limited forthe person’s
appearance.˙Answer by way of cross action15.Theplaintiffmaysetupinanswertoacounterclaimanymatterarising out of
the facts alleged in the counterclaim which would be
availableto the plaintiff as a defence if the
counterclaim were a statement of claim inan action against
the plaintiff, whether such answer is in the nature of across
action or not.˙Exclusion of counterclaim16.When a defendant sets up a
counterclaim against any other personnot a party to
the action, if such person contends that the claim therebyraised ought to be disposed of in an
independent action, the person may, atany time before
delivering his or her answer, apply to the Court or a Judgefor
an order that such counterclaim may be struck out; and the Court or
aJudge may, on the hearing of such
application, make such order as may bejust.˙Discontinuance17.If,
in any case in which the defendant sets up a counterclaim,
theaction of the plaintiff is stayed,
discontinued, or dismissed, the counterclaimmay nevertheless
be proceeded with.˙Judgment for balance18.When,inanyactionforapecuniarydemand,aset-offorcounterclaim for a pecuniary demand is
established as a defence against theplaintiff’s
claim, the Court or a Judge may, if the balance is in favour of
thedefendant,givejudgmentforthedefendantforsuchbalance,ormayotherwiseadjudgetothedefendantsuchreliefasthedefendantmaybeentitled to upon the merits of the
case.
165Rules of the Supreme Court˙Notice in probate actions19.In probate actions the party opposing
a will may, with his or herdefence, give
notice to the party setting up the will that the party
merelyinsists upon the will being proved in solemn
form of law, and only intendstocross-examinethewitnessesproducedinsupportofthewill;andtheparty shall thereupon be at liberty to
do so, and shall not in any event beliable to pay the
costs of the other party, unless the Court or Judge is ofopinion that there was no reasonable ground
for opposing the will.˙Plea in
abatement20.No defence shall be pleaded in
abatement.˙Actions for recovery of land21.Without prejudice to rules 1 to 20, a
defendant to an action for therecovery of land
must plead specifically every ground of defence on whichthe
defendant relies, and a plea that the defendant is in possession of
theland personally or by his or her tenant shall
not be sufficient.†ORDER 26—OFFER TO SETTLE˙Interpretation1.In
this order—“defendant”includes a
defendant to a counterclaim and a party againstwhom a claim is
made in accordance with order 17.“offer to
settle”means an offer to settle made in accordance
with this orderand offer has a corresponding
meaning.“plaintiff”includes a
defendant who makes a counterclaim or who makesa claim in
accordance with order 17.
166Rules of the Supreme Court˙Where offer to settle available2.(1)A party may
serve on any other party an offer to settle any 1 ormore
of the claims in a cause or matter on the terms specified in the
offer tosettle.(2)A
party may serve more than 1 offer to settle.(3)Anoffertosettlemadeinaccordancewiththisordershallbeinwriting and shall contain a statement
that it is made in accordance with thisorder.˙Time for making offer3.(1)An offer to
settle shall be served in the case of a jury trial, at anytime
before a verdict is returned, and subject to subrules (2) and (3)
wherethe trial is by any other mode, before the
judgment is given.(2)Where an account is claimed in the
first instance or where a claiminvolvestakinganaccountanoffertosettlemaybeservedatanytimebefore the
certificate under order 67, rule 49 becomes final and
binding.(3)Wherethereisaninterlocutoryjudgmentfortheassessmentofdamages an offer to settle may be served at
any time before the damages areassessed.˙Withdrawal or expiry of offer4.(1)A party shall
specify in an offer to settle a period, expiring not lessthan
14 days after the day of service of the offer, during which the
offer isopen for acceptance, and the offer shall not
be withdrawn during that periodwithout the leave
of the Court.(2)An offer to settle lapses at the
expiration of the period during which itis specified to
be open.(3)The Court may, at any time within
which an offer to settle is open foracceptance, grant
leave to a party to withdraw the offer to settle but the
offermay be accepted at any time before the
determination of the application forleave to withdraw
it.(4)Subrule (2) has effect even though at
the expiry of the period foraccepting the
offer to settle an application for leave to withdraw it has
not
167Rules of the Supreme Courtbeen
determined by the Court.(5)TheCourtshallnot,notwithstandinganyotherprovisionoftheserules, extend the
time for accepting an offer to settle.˙Effect
of offer5.An offer to settle made in accordance
with this order shall be taken tobe an offer made
without prejudice.˙Disclosure of offer6.(1)Subject to rule 12, no statement of the fact
than an offer to settle inaccordance with this order has been
made shall be contained in any pleadingor
affidavit.(2)Where an offer to settle is not
accepted, no communication in respectoftheoffershallbemadetotheCourtatthetrialorhearinguntilallquestions of liability and the relief
to be granted, except costs, have beendetermined.˙Acceptance of offer7.(1)Acceptanceofanoffertosettleshallbeeffectedbyservingawritten notice of acceptance on the offeror
or on the offeror’s solicitor.(2)An
offer to settle does not lapse on the making of a counter offer
tosettle.(3)Where an offeree rejects an offer or makes a
counter offer to settlewhich is not accepted the offeree may
subsequently accept the original offerto settle during
the period that it is open for acceptance.(4)Where an offer to settle is accepted the
Court may incorporate any ofits terms into a
judgment.(5)An offer to settle providing for the
payment of a sum of money shall,unlessitotherwiseprovides,betakentobeanofferprovidingforthepayment of that sum within 14 days
after acceptance of the offer.
168Rules of the Supreme Court˙Legal disability8.A
party who is under a legal disability may make or accept an offer
tosettle in accordance with this order but the
acceptance of an offer to settle isnot binding on
the disabled party unless it is approved in accordance withthePublic Trustee Act 1978,
section 59.˙Costs9.(1)Where the plaintiff makes an offer to settle
which is not accepted bythe defendant and the plaintiff obtains
a judgment no less favourable thanthe offer to
settle the Court shall order the defendant to pay the
plaintiff’scosts fixed on a solicitor and client basis,
unless the defendant shows thatanother order for
costs is proper in the circumstances.(2)Where the defendant makes an offer to settle
which is not accepted bytheplaintiffandtheplaintiffobtainsajudgmentwhichisnotmorefavourable to the plaintiff than the offer to
settle the Court shall order thedefendant to pay
the plaintiff’s costs, fixed on a party and party basis, up
toand including the day of service of the offer
to settle and order the plaintiffto pay the
defendant’s costs, fixed on a party and party basis, after the
dayof service of the offer to settle, unless the
plaintiff shows that another orderfor costs is
proper in the circumstances.(3)For
the purposes of subrule (2), where the offer to settle is served
onthe first or later day of the trial then
unless the Court orders otherwise theplaintiff is
entitled to his or her party and party costs to the opening of
theCourtonthenextdayofthetrialandthedefendantisentitledtothedefendant’s party and party costs
incurred after the opening of the Court onthat day.(4)Where the plaintiff obtains judgment
for the recovery of a debt ordamages
and—(a)the amount of the judgment includes
interest or damages in thenature of interest; or(b)under any Act the Court awards the
plaintiff interest or damagesin the nature of
interest;for the purposes of making an order for costs
under subrule (1) or (2) theCourt shall
disregard the interest or damages in the nature of interest
thatrelates to the period after the day of
service of the offer to settle.
169Rules of the Supreme Court(5)Subrules (1) and (2) shall not apply
unless the Court is satisfied bythe party serving
the offer that that party was at all material times willingand
able to carry out his or her part of what was proposed in the
offer.˙Multiple defendants10.(1)Subject to subrule (2) where there are 2 or
more defendants, theplaintiff may offer to settle with any
defendant, and any defendant mayoffer to settle
with the plaintiff.(2)Where defendants are alleged to be
jointly or jointly and severallyliabletotheplaintiffandrightsofcontributionorindemnitymayexistbetweenthedefendants,thisorderdoesnotapplytothatoffertosettleunless—(a)in the case of an offer made by the
plaintiff—the offer is made toall of the
defendants and is an offer to settle the claim against allthe
defendants; or(b)in the case of an offer made to the
plaintiff—(i)the offer is an offer to settle the
plaintiff’s claim against allthe defendants;
and(ii)where the offer
is made by 2 or more defendants—by thetermsoftheofferthedefendantswhomaketheofferarejointly or jointly and severally liable to
the plaintiff for thewhole of the amount of the
offer.˙Offer to contribute11.(1)Where a defendant makes a claim (a“contribution claim”) torecoveracontributionoranindemnityagainstanyperson,whetheradefendant to the proceeding or not, in
respect of any claim for a debt ordamagesmadebytheplaintiffintheproceeding,anypartytothecontribution claim may serve on any
other party to the contribution claim anoffer to
contribute towards the settlement of the claim made by the
plaintiffon the terms specified in the offer.(2)The Court may take account of an offer
to contribute in determiningwhether it should
order that the party on whom the offer to contribute wasserved should pay the whole or part
of—
170Rules of the Supreme Court(a)the costs of the party who made the
offer; and(b)any costs which that party is liable
to pay to the plaintiff.(3)Rules 5 and 6
apply, with such modification as is necessary to anoffer
to contribute as if it were an offer to settle.˙Failure to comply with offer12.Where a party does not comply with an
accepted offer to settle theother party may
elect to—(a)apply to the Court for judgment in the
terms of the offer and theCourt may give that judgment;
or(b)continue with the proceeding as if an
offer to settle had not beenaccepted.†ORDER 27—REPLY, ANSWER, AND
SUBSEQUENTPLEADINGS˙Reply1.A party shall
deliver the party’s reply (if any) within 14 days from thedelivery of the defence (or answer to the
counterclaim as the case may be)or within such
other time as the Court or a Judge or registrar shall order.˙Pleading by leave after reply2.No pleading subsequent to reply other
than a joinder of issue shall bepleaded without
leave of the Court or a Judge, and then shall be pleadedonly
upon such terms as the Court or Judge shall think fit.
171Rules of the Supreme Court†ORDER 28—MATTERS ARISING PENDING
THEACTION˙Before
defence1.(1)Any ground of
defence which has arisen after action brought, butbefore the defendant has delivered his or her
defence, and before the timelimitedforthedefendantdoingsohasexpired,maybesetupbythedefendant in his
or her defence, either alone or together with other groundsof
defence.(2)And if, after a defence has been
delivered, any ground of defencearises to any
set-off or counterclaim alleged therein by the defendant, it
maybe set up by the plaintiff or any other
defendant to the counterclaim in his orher reply or
answer, either alone or together with any other ground of
replyor answer.˙Further defence or answer2.When
any ground of defence arises after the defendant has delivered
adefence, or after the time limited for the
defendant doing so has expired, thedefendantmay,andwhenanygroundofdefencetoanyset-offorcounterclaimarisesafterreplyoranswer,orafterthetimelimitedfordelivering a reply or answer has
expired, the plaintiff or any other defendantto the
counterclaim may, within 8 days after such ground of defence
hasarisen, or, by leave of the Court or a Judge,
at any subsequent time, delivera further defence
or a further reply or further answer, as the case may be,setting forth such ground of defence.˙Confession of defence3.When any defendant, in his or her
defence, or in any further defencedelivered as in
rule 2 mentioned, alleges any ground of defence which hasarisen after the commencement of the action,
the plaintiff may deliver aconfession of
such defence in the form in schedule 1, with such variationsas
circumstances may require, and may thereupon sign judgment for
theplaintiff’s costs up to the time of the
pleading of such defence, with costs ofjudgment, unless
the Court or a Judge, either before or after the delivery ofsuch
confession, otherwise orders.
172Rules of the Supreme Court†ORDER 29—DEMURRER˙Demurrer1.Any
party may demur to any pleading of the opposite party, or to
anypart of a pleading which sets up a distinct
cause of action, or to any distinctand severable
claim for damages, or to any claim for damages exceeding anamountnamedbythedemurringparty,ortoanypleadingorpartofapleading of the opposite party which
sets up a distinct ground of defence,set-off,
counterclaim, reply, or answer, as the case may be, on the
groundthat the facts alleged do not show any cause
of action, claim for damages, orground of
defence, set-off, counterclaim, reply or answer, as the case
maybe, to which effect can be given by the Court
as against the party demurring.˙Demurrer to state whether the whole or
part—groundfrivolous—demurrer set aside with
costs2.(1)A demurrer must
state specifically whether it is to the whole or to apart,
and if so to what part, of the claim or pleading of the opposite
party.(2)Itmuststatesomegroundinlawforthedemurrer,butthepartydemurringshallnotontheargumentofthedemurrerbelimitedtotheground so stated.(3)A
demurrer shall be in one of the forms in schedule 1.(4)If no ground or only a frivolous
ground of demurrer is stated, theCourt or a Judge
may set the demurrer aside with costs.˙Delivery3.A
demurrer shall be delivered in the same manner and within the
sametime as any other pleading.˙Demurrer and defence in 1
pleading4.When a party entitled to put in a
pleading desires both to demur andplead to the last
pleading of the opposite party, or to demur to part of the
lastpleading of the opposite party and to plead
to other part thereof, the partyshall combine
such demurrer and other pleading.
173Rules of the Supreme Court˙Leave to plead and demur together not
necessary5.(1)Any party may
plead and demur to the same matter without leave.(2)When a party demurring pleads as well
as demurs, it shall be in thediscretion of the
Court or a Judge to direct whether the issues of law or factshall
be first disposed of.˙Demurrer to claim
founded on document6.(1)When the claim
or defence of any party depends, or may depend,upon the
construction of a written document, and the party in the
party’spleading refers to the document but does not
set it out at length, the oppositeparty may, in the
opposite party’s demurrer, set out the document at length,orsomuchthereofasismaterial,anddemurtotheclaimordefencefounded upon it,
in the same manner as if it had been pleaded at length bythe
other party.(2)If the party does not set out the
document truly or sufficiently, theCourt or a Judge
may order the demurrer to be struck out or amended.˙Demurrer not entered for argument to be
held sufficient7.(1)Whenademurrer,eithertothewholeorpartofapleading,isdelivered,eitherpartymaysetdownthedemurrerforargumentimmediately, and
the party setting down the demurrer shall on the same daygive
notice thereof to the other party.(2)If
the demurrer is not set down and notice given within 10 days
afterdelivery, and if the party whose pleading or
claim is demurred to does notwithin such time
amend, the demurrer shall be held sufficient for the samepurposes and with the same result as to costs
as if it had been allowed onargument, and the
same judgment may be entered thereon.˙Amendment pending demurrer8.While a demurrer to the whole or any
part of a pleading is pending,such pleading
shall not be amended except on payment of the costs of thedemurrer, unless by leave of the Court or a
Judge.
174Rules of the Supreme Court˙Costs when demurrer allowed9.When a demurrer to the whole or part
of any pleading or claim isallowed upon
argument, the party whose pleading or claim is demurred toshallpaytothedemurringpartythecostsofthedemurrer,andwhenademurrer is overruled the demurring party
shall pay to the opposite partythecostsoccasionedbythedemurrer,unlessineithercasetheCourtotherwise
orders.˙Effect of decision on demurrer going to
whole action10.Subject to the power of amendment,
when a demurrer to the wholeof any pleading,
so far as it relates to a separate cause of action, is
allowedor overruled, the Court shall give such
judgment as to that cause of action asupon the
pleadings the successful party appears to be entitled to, and, if
thejudgment is for the defendant with respect to
the whole action, the plaintiffshall pay to the
defendant the costs of the action, unless the Court
otherwiseorders.˙Where
demurrer allowed to part of a pleading that part is to bedeemed
to be struck out11.When a demurrer to any pleading or
claim or part of a pleading orclaim is allowed
in any case not falling within rule 10, then, subject to thepower
of amendment, the matter demurred to shall as between the parties
tothe demurrer be deemed to be struck out of
the pleadings, and the rights ofthe parties shall
be the same as if it had not been pleaded.˙Demurrer overruled with leave to plead12.When a demurrer is overruled, the
Court may make such order, andupon such terms,
as to the Court shall seem fit, for allowing the demurringparty
to raise by further pleading any case which the demurring party
maydesire to set up in opposition to the matter
demurred to.˙Form of entry for argument13.A demurrer shall be set down for
argument by filing a copy of thepleadings so far
as they relate to the matters of law raised by the
demurrer,
175Rules of the Supreme Courtanddeliveringtotheregistraramemorandumofentryintheforminschedule 1.˙When
demurrer required to be heard before Court of Appeal14.When the party entering a demurrer for
argument enters it to be heardbefore a single
Judge, and any other party requires it to be heard before
theCourt of Appeal in the first instance, the
other party must, within 4 daysafter receiving
notice that the demurrer has been so entered, deliver to theregistrar and to the opposite party a
memorandum in the form in schedule 1or to the like
effect, and the demurrer shall thereupon be deemed to havebeen
entered to be heard before the Court of Appeal in the first
instance.˙Pleadings for Judges16.Four days at least before the day for
which a demurrer is set downfor argument, the
party setting it down shall leave at the chambers of theJudge,oratthechambersofeachoftheJudgeswhoaretositonthehearing of the
argument, a copy of the pleadings so far as they relate to
thematters of law raised by the demurrer.†ORDER 30—DISCONTINUANCE ETC.˙Discontinuance of action before
defence1.(1)Theplaintifforacounterclaimingdefendantmay,atanytimebeforereceiptofthedefenceofanydefendantoranyanswertothecounterclaim, or after the receipt of
the defence or answer, but before takingany other
proceeding in the action against such defendant or plaintiff
ordefendant to the counterclaim other than an
interlocutory application, bynoticeinwritingwhollydiscontinuehisorheractionorcounterclaimagainst such
party, or may withdraw any part or parts of his or her
allegedcauseofactionagainstsuchparty,andthereupontheplaintifforcounterclaiming defendant shall pay such
party his or her costs of the actionor counterclaim,
or, if the action or counterclaim is not wholly
discontinued,the taxed costs occasioned by the matter so
withdrawn.
176Rules of the Supreme Court(2)Such discontinuance or withdrawal, as
the case may be, shall not be adefence to any
subsequent action for the same cause.˙Not
otherwise except by leave2.(1)Saveasinthisorderprovided,itshallnotbecompetentforaplaintiff to withdraw the record or
discontinue the action without leave ofthe Court or a
Judge.(2)But the Court or a Judge may, before,
or at, or after, the hearing ortrial, upon such
terms as to costs, and as to bringing any other action orotherwise, as may be just, order the action
to be discontinued, or any part ofthe alleged cause
of action to be struck out.˙Court
may allow a defendant to discontinue his or her defence3.The Court or a Judge may, in like
manner, and with the like discretionas to terms, upon
the application of a defendant, or of a plaintiff or otherperson defendant to a counterclaim, order the
whole or any part of his or herdefence or
counterclaim to be withdrawn or struck out; but it shall not
becompetent to any defendant to withdraw his or
her defence or counterclaim,or any part
thereof, without such leave.˙Effect
on consolidated actions and on counterclaims4.The
discontinuance of an action by the plaintiff shall not prejudice
anyaction consolidated therewith, or any
counterclaim previously set up by thedefendant.˙Withdrawal by consent5.When a cause has been entered for
trial, it may be withdrawn by eitherthe plaintiff or
the defendant, upon production to the proper officer of aconsent in writing, signed by the
parties.˙Entering judgment on
discontinuance6.A defendant may enter judgment for the
costs of the action if it iswholly
discontinued against the defendant, or for the costs occasioned
by
177Rules of the Supreme Courtthe
matter withdrawn, if the action is not wholly discontinued, in case
suchrespective costs are not paid within 4 days
after taxation.†ORDER 31—DEFAULT OF PLEADING˙Default of plaintiff in delivering
statement of claim1.If a plaintiff, being bound to deliver
a statement of claim, does notdeliver the same
within the time allowed for that purpose, the defendantmay,
at the expiration of that time, apply to the Court or a Judge to
dismissthe action with costs for want of
prosecution; and on the hearing of suchapplicationtheCourtorJudgemayordertheactiontobedismissedaccordingly, or
may make such other order on such terms as may be just.˙Entry of judgment by post1A.(1)This rule
applies if the plaintiff seeks to enter judgment under thisorder
by post.(2)The documents filed to enter judgment
must include—(a)a notice stating the rule under which
the plaintiff is seeking toenter judgment;
and(b)anaffidavitbytheplaintiff,attestedonthedayitisposted,deposing that a defence has not been
delivered to the plaintiff.(3)The affidavit
under subrule (2)(b) may be relied on, for this rule, untilthe
end of 5 days after the day it is attested.(4)If,
before receiving the duplicate judgment, a defence is delivered
totheplaintiff,theplaintiffmustimmediatelygivewrittennoticetotheregistrar.(5)The registrar may enter judgment in
default of delivery of defenceif—(a)the documents mentioned in subrule (2)
have been filed; and(b)the plaintiff
has otherwise complied with this order in seeking toenter judgment; and
178Rules of the Supreme Court(c)the registrar is satisfied a defence
has not been delivered underthese
rules.(6)If,afterenteringjudgmentindefaultofdeliveryofdefence,theregistrar becomes satisfied that a defence
was delivered under these rulesbefore judgment
was entered, the registrar must withdraw the judgment andnotify the parties.(7)In
this rule—“plaintiff”means the
plaintiff’s solicitor or, if the plaintiff sues in person,the
plaintiff.˙Liquidated demand2.(1)If
the plaintiff’s claim is for a debt or liquidated demand only,
andthe defendant fails, or all the defendants,
if more than 1, fail, to deliver adefence within
the time allowed for that purpose, the plaintiff may, at theexpirationofsuchtime,enterfinaljudgmentagainstthedefendantordefendants for the amount claimed, together
with interest at the rate claimedby the statement
of claim as the rate agreed upon (if any) or, if no rate isclaimed to have been agreed upon, at the rate
of 10% per annum to the dateof the judgment,
with the plaintiff’s costs of action.(2)However, if the solicitor for the plaintiff
files a notice electing toaccept costs endorsed on the writ
pursuant to order 6, rule 8 together withcostsfixedunderorder15,rule16(ifany)infullsatisfactionoftheplaintiff’s costs recoverable from the
defendant, the final judgment may beentered for the
plaintiff for the amount of such costs in lieu of the
plaintiff’scosts of action.˙Liquidated demand—several defendants3.Whentheclaimisforadebtorliquidateddemand,andthereareseveraldefendants,if1ormoreofthemmakesormakedefaultasmentioned in rule 2, the plaintiff may
enter final judgment as by that ruleprovided against
the defendant or defendants so making default.
179Rules of the Supreme Court˙Interlocutory judgment for
damages4.If the plaintiff’s claim is, as
against any defendant, for unliquidateddamages only, and
that defendant does not, within the time allowed for thatpurpose, deliver a defence, the plaintiff may
enter interlocutory judgmentagainst the
defendant for damages to be assessed and costs, and proceedwith
the action against the other defendants (if any).˙Detention of goods—interlocutory
judgment for return, assessment ofvalue and
damages5.(1)If the
plaintiff’s claim is, as against any defendant, for the
detentionof goods only, and that defendant does not,
within the time allowed for thepurpose, deliver
a defence, the plaintiff may enter interlocutory judgmentagainstthedefendantforthereturnofthegoodsortheirvaluetobeassessed, and
costs, or at the option of the plaintiff, interlocutory
judgmentfor the value of the goods to be assessed and
costs, and proceed with theaction against
the other defendants (if any).(2)If
the plaintiff’s claim is, as against any defendant, for the
detentionof goods and also for unliquidated damages,
but no other claim is made asagainst that
defendant and that defendant does not, within the time
allowedforthatpurpose,deliveradefence,theplaintiffmayenterinterlocutoryjudgment against
the defendant for the return of the goods or their value tobeassessed,damagestobeassessedandcosts,or,attheoptionoftheplaintiff,
interlocutory judgment for the value of the goods to be
assessed,damages to be assessed and costs, and proceed
with the action against theother defendants
(if any).˙Detention of goods, damages and
liquidated demand6.If the plaintiff’s claim is, as
against any defendant—(a)for unliquidated
damages, or for the detention of goods, or forunliquidated
damages and the detention of goods; and also(b)for
a debt or liquidated demand with or without interest;and
no other claim is made against that defendant, and that defendant
doesnot, within the time allowed for that
purpose, deliver a defence, the plaintiffmayenteragainstthatdefendant,asrespectstheclaimorclaimsfor
180Rules of the Supreme Courtdamages or detention of goods, such
interlocutory judgment (with costs) asis provided for
by rules 4 and 5, and such final judgment (with costs) inrespect of the claim for the debt or
liquidated demand as is provided for byrule 2 or 6A, and
proceed with the action against the other defendants (ifany).6A.If the
plaintiff’s claim is or includes a claim for a debt or
liquidateddemand together with a claim for interest
under theCommon Law PracticeAct 1867,
then upon such defaults as are hereinbefore referred to—(a)if the plaintiff elects to abandon the
claim for such interest—theplaintiff’s
claim shall, for the purposes of this order be deemed tobe
for such debt or liquidated demand without such interest andthe
plaintiff may enter judgment accordingly; and(b)if
the plaintiff elects to accept interest at a rate not higher than
thatspecified in a practice direction issued
from time to time by theChiefJusticeinrespectofanyperiodmentionedinthedirection—the
registrar has power to award interest in accordancewith
the direction (whether or not the defendant has paid the
debtor liquidated demand after action brought)
and the plaintiff mayenter final judgment against the
defendant in default accordingly;and(c)if the plaintiff seeks to recover a
higher rate of interest than thatspecified in a
practice direction mentioned in paragraph (b)—theCourtoraJudgemaydeterminetheinterest(ifany)thatisrecoverableandmaydirectthatjudgmentbeenteredfortheinterest(whetherornotthedefendanthaspaidthedebtorliquidated demand after action brought) and
may otherwise directthat judgment be entered as provided
by this order; and(d)if the period for which interest is to
be awarded is not specified inthe statement of
claim—interest must be allowed only from thedate of the
writ.˙Recovery of land7.In
an action for the recovery of land, if any defendant does not,
withinthe time allowed for that purpose, deliver a
defence, the plaintiff may enter
181Rules of the Supreme Courtfinaljudgmentthatthepersonwhosetitleisassertedinthewritofsummons shall as against that defendant
recover possession of the land,with the
plaintiff’s costs of action, upon the production of a certificate
by thesolicitor for the plaintiff or, in the case
of a plaintiff in person, of an affidavitthat the action
is not one to which order 6, rule 11B applies.˙Recovery of land and other claims8.Wheninanactionfortherecoveryoflandtheplaintiffhasalsoendorsed upon the
writ a claim for mesne profits, arrears of rent or doublevalue
or any other claim mentioned in rules 2 to 6, if any defendant
doesnot, within the time allowed for that
purpose, deliver a defence, the plaintiffmay enter
judgment against the defendant as provided in rule 7 with
respectto the land; and may proceed as mentioned in
rules 2 to 6 with respect to theplaintiff’s other
claim so endorsed.˙Defence to part of claim only9.(1)If the
plaintiff’s claim is for a debt or liquidated demand, or forpecuniary damages only or for the detention
of goods with or without aclaim for pecuniary damages, or for any
of such matters, or for the recoveryof land, and the
defendant delivers a defence, which purports to offer ananswer to part only of the plaintiff’s
alleged cause of action, the plaintiffmay,byleaveoftheCourtoraJudge,enterjudgment,finalorinterlocutory, as the case may be, for
the part unanswered.(2)However, the unanswered part consists
of a separate cause of action,or is severable
from the rest, as in the case of part of a debt or
liquidateddemand.(3)Inaddition,whenthereisacounterclaim,executiononanysuchjudgment as above mentioned in respect of the
plaintiff’s claim shall notissue without
leave of the Court or a Judge.˙Probate actions10.In
probate actions, if any defendant makes default in delivering
adefence, the action may proceed,
notwithstanding such default.
182Rules of the Supreme Court˙Default in other cases11.Inallotheractionsthanthoseinrules1to10mentioned,ifthedefendant makes default in delivering a
defence, the plaintiff may set downtheactionasagainstthedefendantonmotionforjudgment,andsuchjudgment shall be
given as upon the statement of claim the plaintiff appearsto be
entitled to.˙One of several defendants in
default12.(1)When,inanysuchactionasmentionedinrule11,thereareseveraldefendants,then,ifanydefendantmakesdefaultindeliveringadefence, the plaintiff may, if the cause of
action is severable, set down theactionatonceonmotionforjudgmentagainstthedefendantsomakingdefault, or may
in any case set it down on motion for judgment against thedefendant at the time when it is entered for
trial or set down on motion forjudgment against
the other defendants.(2)In the first
case the Court may adjourn the motion to come on at thetime
lastmentioned.˙When statements of fact put in
issue13.(1)If no reply is
delivered, then at the expiration of 14 days from thedelivery of the defence (or answer to the
counterclaim, as the case may be)the pleadings
shall be deemed to be closed and all material statements offact
in the defence (or answer) shall be deemed to have been denied and
putin issue.(2)If a
reply or subsequent pleading is delivered, all material
statementsof fact in the pleading last delivered shall
at the expiration of 14 days fromthe delivery
thereof be deemed to have been denied and put in issue.˙Judgment by default in other
cases14.(1)Inanycasenothereinbeforeprovidedfor,ifanypartymakesdefault in delivering any pleading, the
opposite party may apply to the Courtor a Judge for
such judgment (if any) as upon the pleadings the oppositeparty
may appear to be entitled to.(2)AndtheCourtorJudgemayorderjudgmenttobeentered
183Rules of the Supreme Courtaccordingly,ormaymakesuchotherorderasmaybenecessarytodocomplete justice between the
parties.˙Setting aside judgment by
default15.Any judgment by default under this
order may be set aside or variedby the Court or a
Judge, upon such terms as to costs or otherwise as theCourt
or Judge may think fit.˙Effect of judgment
by default16.In any case in which a plaintiff
enters judgment under the provisionsof this order
against 1 or more of several defendants who makes or makedefault in delivering a defence, such entry
of judgment shall not, nor shallthe issue of
execution thereon, prejudice the plaintiff’s right to proceed
inthe action against the other defendant or
defendants.˙Counterclaims17.Theprovisionsofthisordershallapplytocounterclaims,andtoproceedings thereon, as if the
counterclaim were a statement of claim, andthe defendant
setting up the counterclaim were a plaintiff.†ORDER 32—AMENDMENT˙Amendment in general1.(1)The
Court or a Judge may, in any cause or matter, at any stage
ofthe proceedings, allow or direct either party
to alter or amend the writ ofsummons,oranyendorsementthereon,oranypleadingsorotherproceedings, in
such manner and on such terms as may be just.(2)Where an application to the Court or a Judge
for leave to make theamendment mentioned in subrule (3), (4)
or (5) is made after any relevantperiod of
limitation current at the date of the issue of the writ has
expired,the Court or a Judge may nevertheless grant
such leave in the circumstances
184Rules of the Supreme Courtmentioned in that subrule if the Court or
Judge thinks it just to do so.(3)An
amendment to correct the name of a party may be allowed
undersubrule(2)notwithstandingthatitisallegedthattheeffectoftheamendmentwillbetosubstituteanewpartyiftheCourtorJudgeissatisfied that the mistake sought to be
corrected was a genuine mistake andwasnotmisleadingorsuchastocauseanyreasonabledoubtastotheidentity of the person intending to sue or,
as the case may be, intended to besued.(4)An amendment to alter the capacity in
which a party sues (whether asplaintiff or as
defendant by counterclaim) may be allowed under subrule (2)if
the capacity in which, if the amendment is made, the party will sue
is onein which at the date of issue of the writ or
the making of the counterclaim,as the case may
be, the party might have sued.(5)An
amendment may be allowed under subrule (2) notwithstandingthat
the effect of the amendment will be to add or substitute a new
cause ofaction if the new cause of action arises out
of the same facts or substantiallythe same facts as
a cause of action in respect of which relief has alreadybeenclaimedintheactionbythepartyapplyingforleavetomaketheamendment.(6)Subject to this rule, an amendment may be
allowed under this rulenotwithstandingthattheeffectoftheamendmentwouldbetoaddorsubstitute a cause of action arising
after the issue of the writ of summons orother proceedings
by which the proceedings were commenced.˙Amendment of writs of summons2.(1)When a writ of
summons or any endorsement thereon is amended,theamendmentshallbemadeinsuchmannerastodistinguishtheamendments from the original matter, and the
writ shall be resealed.(2)A copy thereof,
as amended, shall be filed, unless the Court or Judgeallows the amendment to be made upon the copy
of the original alreadyfiled.˙Amendment of statement of claim by plaintiff
without leave3.The plaintiff may, without any leave,
amend the plaintiff’s statement
185Rules of the Supreme Courtof
claim, whether endorsed on the writ or not, once at any time before
theexpiration of the time limited for reply and
before replying, or, where nodefence is
delivered, at any time before the expiration of 4 weeks from
theappearance of the defendant who shall have
last appeared, or where defenceis delivered, but
no order for reply is made within 10 days from delivery ofthe
defence or the last of the defences.˙Amendment of counterclaim or set-off by
defendant without leave4.A defendant who
has set up any counterclaim or set-off may, withoutanyleave,amendsuchcounterclaimorset-offatanytimebeforetheexpiration of the time allowed the
defendant for answering the reply, andbefore such
answer, or in case there be no reply, then at any time before
theexpiration of 28 days from defence.˙Disallowance of amendment5.Whenanypartyhasamendedtheparty’spleadingorendorsementunder either rule
3 or 4, the opposite party may, within 8 days after thedeliverytotheoppositepartyoftheamendedpleadingorendorsement,applytotheCourtoraJudgetodisallowtheamendment,oranypartthereof, and the
Court or Judge may, if satisfied that the justice of the
caserequires it, disallow the same, or may allow
it subject to such terms as tocosts or
otherwise as may be just.˙Pleading to
amended pleading6.Whenanypartyhasamendedtheparty’spleadingorendorsementunder rule 3 or
4, the opposite party shall plead to the amended pleading orendorsement,oramendhisorherpleading,withinthetimewhichtheopposite party then has to plead, or
within 8 days from the delivery of theamendment,
whichever shall last expire; and in case the opposite party
haspleaded before the delivery of the amendment,
and does not plead again oramend within the
time above mentioned, the opposite party shall be deemedtorelyonhisorheroriginalpleadinginanswertosuchpleadingasamended.
186Rules of the Supreme Court˙Amendment by leave7.In
any case not provided for by rules 1 to 6, application for leave
toamend any pleading or endorsement may be made
by either party to theCourtoraJudge,ortotheJudgeatthetrialoftheaction,andsuchamendment may be
allowed upon such terms as to costs or otherwise asmay
be just.˙Failure to amend after order8.Ifapartywhohasobtainedanorderforleavetoamendanyproceedingdoesnotamendaccordinglywithinthetimelimitedforthatpurpose by the
order, or, if no time is thereby limited, then within 14
daysfrom the date of the order, such leave to
amend shall, on the expiration ofsuch limited time
as aforesaid, or of such 14 days, as the case may be, ceaseto
have effect, unless the time is extended by the Court or a
Judge.˙Amendments of delivered documents how
made9.(1)Any document
which has been delivered to a party to a cause ormatter, and which it is proposed to amend,
may be amended by writtenalterations in the copy which has been
delivered, and by additions on paperto be interleaved
therewith or added thereto if necessary, for which purposethe
party to whom the document has been delivered shall produce it to
theparty desiring to make the amendment.(2)But if the amendments require the
insertion of more than 144 wordsin any 1 place,
or are so numerous or of such a nature that making them inwriting would render the document difficult
or inconvenient to read, theamendment must be
made by delivering a fair copy of the document asamended.˙Date
of order and date of amendment to be marked10.When
any proceeding is amended, it shall, when amended, unlessotherwiseordered,bemarkedwiththedateoftheorder(ifany)underwhich
the same is so amended, and of the day on which such amendment
ismade, in manner following, viz.: ‘Amended
theday of,pursuant to order dated theday
of’.
187Rules of the Supreme Court˙Delivery of amended pleadings11.Whenitisnecessarytodeliverafaircopyofadocumentasamended, such amended document shall be
delivered to the opposite partywithin the time
allowed for amendment.˙Clerical mistakes
and accidental omissions12.Clerical
mistakes in judgments or orders, or errors appearing thereinandarisingfromanyaccidentalsliporomission,mayatanytimebecorrected by the Court or a Judge on
motion or summons, and an appealshall not lie
from an order directing such amendment.˙General power to amend13.The
Court or a Judge may at any time, and on such terms as to
costsor otherwise as the Court or Judge may think
just, amend any defect orerror in any proceedings, and all
necessary amendments shall be made forthe purpose of
determining the real questions in controversy between theparties.˙Costs14.The costs of and
occasioned by any amendment made pursuant torules 3 and 4
shall be borne by the party making the same, unless the
Courtor a Judge otherwise orders.†ORDER 33—SECURITY†1.
Security in general˙General form of security1.Whenever in any cause or matter
security is required to be given by oron behalf of any
party, such security shall, unless otherwise required by lawor by
these rules, or unless otherwise directed by the Court or a Judge,
be
188Rules of the Supreme Courtgivenbyaninstrumentinwritingsignedbythepersontobebound,whetherasprincipalorsurety,andsettingforththatthepersonsubmitshimself or herself to the jurisdiction of the
Court, and consents that, uponthe happening of
the event specified in the instrument, judgment may besigned against the person for the amount for
which the security is given.˙Title—attestation2.(1)The
instrument shall be entitled in the cause or matter in which
thesecurity is given, and shall be executed by
each person to be bound in thepresence of the
registrar or a commissioner of affidavits, who shall satisfyhimself or herself that the person signing it
understands the liability whichthe person
incurs, and that such liability may be enforced against the
personin a summary way.(2)The
sureties may execute the instrument either together or
separately.(3)A commissioner shall not attest a
security on behalf of any person forwhom the person,
or any person in partnership with the person, is acting assolicitor or agent.˙Form
of bond for security3.When a bond is ordered to be given as
security, it shall, unless theCourt or Judge
otherwise orders, be given to the party for whose benefit itis
given.˙Two sureties required4.The security shall, unless otherwise
directed by these rules, or unlessotherwise ordered
by the Court or a Judge, be given by 2 sureties, who shallbe
approved by the registrar or by a Judge as hereinafter provided,
and eachof whom shall be bound in the full amount of
the security.˙Notice of sureties5.(1)Thepartybywhomsecurityistobegivenshallserveontheregistrar, and also on the party for
whose benefit the security is to be given(if any) unless
the security is given before service on such party, a
notice
189Rules of the Supreme Courtsettingforththenames,addresses,anddescriptions,oftheproposedsureties in the
form in schedule 1; and the registrar shall appoint a time
forinquiring into the sufficiency of the
sureties.(2)The party proposing the sureties shall
give at least 24 hours notice tothe opposite
party (if any) of such appointment, and shall state in the
noticethat any objection to the sureties must be
then made.˙Justification of sureties6.Each surety shall, except by consent
of the party for whose benefit thesecurity is to be
given, make an affidavit of his or her sufficiency in theforminschedule1,andthesuretiesshallattendtobecross-examinedbefore the
registrar or a commissioner for affidavits, if required.˙Affidavits of justification7.Every affidavit of sufficiency must
state that the deponent is worthdouble the amount
for which the deponent is to become surety, or, if thatamount exceeds £1 000 ($2 000), is worth £1
000 ($2 000) over and abovewhatwillpayhisorherjustdebts,andoverandabovetheamountforwhich
the deponent is to become surety, and every other sum for which
thedeponent is then surety.˙Registrar to be satisfied8.Iftheregistrarissatisfiedofthesufficiencyofthesureties,theregistrar shall endorse upon the instrument
of security a memorandum thatthe registrar is
so satisfied.˙Reference to Judge9.(1)Eitherpartymayrequirethatanyquestionarisingbeforetheregistrar as to the sufficiency of any surety
shall be referred to a Judge, andthe Judge may
hear and determine such question without any summons forthat
purpose.(2)The determination of the Judge shall
be endorsed by the registrarupon the
instrument of security in manner directed by rule 8.
190Rules of the Supreme Court˙Security to be filed of record10.Every instrument of security made
under this order shall be filed, andshall thereupon
become a record of the Court.˙Enforcement of security11.Any
party claiming to be entitled to enforce the security against
anypersonbywhomitissignedmayapplytoaJudgebysummonsinthecause or matter in which the security
is given for an order that judgment beentered against
the person by whom the security is given in accordance withhis
or her submission, and the Judge may order that judgment be
enteredaccordingly in favour of such party for such
amount as may be just.˙To be filed within
6 months12.No such instrument, and no
recognisance or other security of anykind, shall be
filed after the expiration of 6 months from the time of itsexecution, except by order of the Court or a
Judge, made upon notice to allthe persons by
whom the security was executed or their representatives.˙Payment into court in lieu of
security13.(1)Any party
directed to give security may give the same by payingthe
amount for which security is to be given into court to a separate
accountin the cause or matter (the“security account”) and to abide
the order of theCourt, and giving notice of such payment to
the party for whose benefit thesecurity is to be
given.(2)The notice shall be accompanied by a
duplicate original bank receiptfor the money
paid into court.†2. Security for costs˙Security for costs of plaintiff and
counterclaiming defendant14.(1)A plaintiff
ordinarily resident out of the jurisdiction of the Courtmay
be ordered to give security for costs of the cause, whether the
plaintiffis or is not temporarily within the
jurisdiction.
191Rules of the Supreme Court(2)A defendant setting up a counterclaim
not arising out of the plaintiff’sclaimmaybeorderedtogivesecurityforcostsinanycaseinwhichaplaintiff making the like claim might be so
ordered.˙Second action for same cause15.When a plaintiff who has been ordered
to pay the defendant the costsof a cause,
institutes a fresh cause against the same defendant in respect
ofthe same, or substantially the same, cause of
action, the Court or a Judgemay order the
plaintiff to give security for the costs of such second
cause.˙Security to be given16.When security for costs is ordered to
be given, the security shall beofsuchamountandshallbegivenatsuchtimeortimes,andinsuchmanner, as the
Court or a Judge may direct.˙Amount
of security17.The amount of security shall, unless
the Court or a Judge otherwiseorders, be £150
($300).˙Security not required from sailors in
admiralty actions18.A sailor suing in an admiralty action
for the sailor’s wages or for theloss of the
sailor’s goods or clothes in a collision shall not be required
togive security for costs.˙Staying proceedings20.When
a party is ordered to give security for costs, the action, or
otherproceeding in respect whereof the security is
required to be given, shall bestayed until the
security is given, unless the Court or a Judge otherwiseorders.˙Disposal of money paid into court21.(1)In any case in
which money has been paid into court as security
192Rules of the Supreme Courtfor
costs, when the cause has been finally disposed of, if the party by
whomthe payment into court was made is adjudged
to pay the costs of the cause,or any balance in
respect of the costs of the cause, or any other balance ofcosts
in the cause, to any party or parties for whose security the
paymentwas made, the amount standing to the credit
of the security account in thecause shall,
unless the Court or a Judge otherwise orders, be liable to
beapplied in payment of the costs so ordered to
be paid to such other party orparties.(2)Inanyothercasethepartybywhomthepaymentintocourtwasmade
shall be entitled to have the sum paid out to the party.˙Registrar to certify at conclusion of
cause22.When a cause has been finally disposed
of by consent or otherwisethe registrar shall, on the application
of any party to the cause, and on beingsatisfied that
such party is entitled to have any money standing to the
creditof the security account paid out to the
party, give the party a certificate tothat
effect.˙Saving23.Nothing in rules 14 to 22 shall be construed
to affect the power of theCourt or a Judge to require security
for costs to be given by any party to anycause or matter
in any case in which it is just that such security should begiven.†ORDER 34—RELEASES AND CAVEATS INADMIRALTY ACTIONS˙Release1.Property arrested by warrant in admiralty
actions shall not be releasedexceptundertheauthorityofaninstrumentissuedfromtheregistry(a“release”).
193Rules of the Supreme Court˙Caveat against release2.A party desiring to prevent the
release of any property under arrest,shall file in the
registry a notice, and thereupon a caveat against the
releaseof the property shall be entered in a book,
to be kept in the registry (the“caveat release
book”).˙On payment into
registry3.A party may obtain the release of any
property by paying into court thesum in respect of
which the action has been commenced.˙Release of cargo arrested for freight
only4.Cargo, arrested for freight only, may
be released by filing an affidavitas to the value
of the freight, and by paying the amount of the freight intocourt, or upon an order of the Court or a
Judge upon proof that the freighthas already been
paid.˙In salvage actions5.In
an action for salvage, the value of the property under arrest shall
beagreed, or an affidavit of value filed,
before the property is released, unlessthe Court or a
Judge otherwise orders.˙On filing bail
bond6.A party who has given security in the
sum in respect of which theaction has been
commenced, or paid such sum into court, and, if the actionis
one of salvage, has also filed an affidavit as to the value of the
propertyarrested, shall be entitled to a release for
the same, unless a caveat againstthe release is
outstanding in the caveat release book.˙On
consent or discontinuance or dismissal of action7.A release may also be issued by the
registrar, unless there is a caveatoutstanding in
the caveat release book, on a consent in writing being
filed,signed by the party at whose instance the
property has been arrested, or on
194Rules of the Supreme Courtdiscontinuance or dismissal of the action in
which the property has beenarrested.˙To be left with marshal8.The release, when obtained, shall be
left with the marshal by the partytaking it out,
who shall also at the same time pay all costs, charges, andexpenses, attending the care and custody of
the property while under arrest;and the property
shall thereupon be released.˙Registrar may require Judge’s order9.TheregistrarmayrefusetoissueareleasewithouttheorderofaJudge.˙Liability for delaying release10.A party delaying the release of any
property by the entry of a caveatshallbeliabletobecondemnedinthecostsanddamagesoccasionedthereby, unless
the party shows to the satisfaction of the Court or a Judgegood
and sufficient reason for having done so.˙Caveat
against warrant to arrest11.A party desiring
to prevent the arrest of any property, may cause acaveat against the issue of a warrant for the
arrest thereof to be entered in theregistry.˙Caveat warrant book12.For
the purpose in rule 11 mentioned, the party shall cause to be
filedintheregistryanotice,signedpersonallyorbytheparty’ssolicitor,undertaking to
enter an appearance in any action that may be commencedagainsttheproperty,andtogivesecurityinsuchactioninasumnotexceeding an amount to be stated in the
notice, or to pay such sum intocourt;andacaveatagainsttheissueofawarrantforthearrestoftheproperty shall thereupon be entered in
a book to be kept in the registry (the“caveat warrant
book”).
195Rules of the Supreme Court˙Writ to be served on party entering
caveat13.A plaintiff commencing an action
against any property in respect ofwhich a caveat
has been entered in the caveat warrant book, shall forthwithserve
a copy of the writ upon the party on whose behalf the caveat has
beenentered, or upon the party’s
solicitor.˙Security to be given within 3
days14.The party on whose behalf the caveat
has been entered shall, if thesuminrespectofwhichtheactioniscommenceddoesnotexceedtheamountforwhichthepartyhasundertaken,givesecurityinsuchsumwithin 3 days from the service of the
writ.˙If security not given, action may
proceed as on default15.After the
expiration of 12 days from the filing of the notice in rule
12mentioned, if the party on whose behalf the
caveat has been entered has not,within 3 days
from the service of the writ, given security as required byrule14,theplaintiffmayproceedwiththeactionasupondefaultofappearance.˙Judgment may be enforced by attachment and
warrant16.If, when the action comes before the
Court, the Court is satisfied thatthe claim is well
founded, it may pronounce for the amount which appearsto be
due, and may enforce payment thereof by attachment against the
partyon whose behalf the caveat has been entered,
as well as by the arrest of theproperty,ifitthenis,orthereaftercomes,withinthejurisdictionoftheCourt.˙Arrest
notwithstanding caveat17.Nothingintheserulesshallpreventasolicitorfromtakingoutawarrant for the arrest of any property,
notwithstanding the entry of a caveatin the caveat
warrant book; but the party at whose instance any property
inrespect of which the caveat was entered has
been arrested shall be liable tohave the warrant
discharged, and to be condemned in costs and damages,
196Rules of the Supreme Courtunless the party shows to the satisfaction of
the Court or Judge good andsufficient reason
for having so done.˙Caveat payment book18.A
book shall be kept in the registry (the“caveat payment
book”) inwhich caveats
shall be entered against the payment of money out of court
inadmiralty actions.˙Address of caveator19.If
the person entering a caveat is not a party to the action, the
noticeshall state the person’s name and address,
and an address within 1 mile ofthe registry, at
which it shall be sufficient to leave all documents required
tobe served upon the person.˙Withdrawal of caveats20.Acaveatmayatanytimebewithdrawnbythepersonatwhoseinstance it has
been filed, on the person filing a notice withdrawing it.˙Caveat may be overruled21.The Court or a Judge may set aside any
caveat.†ORDER 35†1.
Disclosure and inspection˙Interpretation1.(1)In
this order—“document”has the meaning
given by theEvidence Act 1977, section
5(1).“trial”includes the
hearing of an action and a proceeding other than an
197Rules of the Supreme Courtaction, but does not include an
interlocutory proceeding.(2)A reference in
an Act, rule or practice direction to discovery of adocument includes a reference to disclosure
under this order.˙Application2.(1)This
order applies to all parties, including—(a)infant parties; and(b)next
friends and guardiansad litemof
infants.(2)This order does not affect—(a)therightofapartytoinspectadocumentifthepartyhasacommoninterestinthedocumentwiththepartywhohaspossession or control of the document;
or(b)any other right of access to the
document apart from under thisorder.˙Nature of disclosure3.Disclosure is the delivery or
production of documents in accordancewith this
order.˙Duty to disclose documents4.(1)A party to an
action has a duty to disclose to each other party eachdocument that—(a)is
in the possession or under the control of the first party;
and(b)is directly relevant to an allegation
in issue in the cause.(2)The duty of
disclosure continues until the cause is determined.(3)An allegation remains in issue until
it is—(a)admitted or taken to be admitted;
or(b)withdrawn, struck out or otherwise
disposed of.
198Rules of the Supreme Court˙Documents to which disclosure does not
apply5.(1)The duty of
disclosure does not apply to—(a)a
document in relation to which there is a valid claim to
privilegefrom disclosure; or(b)a
document that relates only to the credit of an individual
whomay testify at the trial; or(c)a document consisting of—(i)a brief or instructions to counsel;
or(ii)advice from
counsel; or(d)anadditionalcopyofadocumentalreadydisclosedifitisreasonabletosupposetheadditionalcopycontainsnomodification,obliterationorothermarkingorfeaturelikelytoaffect the outcome of the
action.(2)A document consisting of a statement
or report of an expert is notprivileged from
disclosure.˙Privilege claim6.(1)A
claim to privilege from disclosure is to be made by
affidavit.(2)The affidavit is to be made by an
individual knowing the facts givingrise to the
claim.(3)The affidavit is to be filed and
served not later than the relevant timementioned in rule
7(2).˙Disclosure by delivery of copies of
documents7.(1)Subject to rules
9 and 14, a party to an action performs the duty ofdisclosure by delivering to the other parties
in accordance with this ordercopies of the
documents to which the duty relates.(2)The
times for the delivery are as follows—(a)ifanorderfordisclosureismadebeforeadefenceisdelivered—the time specified in the
order;(b)when a defence is
delivered;
199Rules of the Supreme Court(c)when any further pleading or amended
pleading is delivered;(d)ifthefirstoccasiononwhichadocumentcomesintothepossession or under the control of the
party, or is located by theparty,happensafteratimementionedinparagraph(a)to(c)—within 7 days after the
occasion;(e)if the party is requested in writing
by another party to deliver acopy of a
document—within 28 days after the request.˙Requirement to produce documents8.Despiterule7,apartymayrequireanotherpartytoproduceforinspection of the first party specified
original documents of which copiesare, or are to
be, disclosed.˙Disclosure by inspection of
documents9.(1)This rule
applies if—(a)it is not convenient for a party to
deliver documents under rule 7because of the
number, size, quantity or volume of the documentsor
some of the documents; or(b)arequirementforproductionofdocumentsismadeofapartyunder rule
8.(2)If this rule applies, the party must
effect disclosure by—(a)producing the
documents for inspection at the time specified inrule
7(2); and(b)notifying the other party in writing
of a convenient place and timeat which the
documents may be inspected.˙Procedure for disclosure10.(1)Ifdisclosureiseffectedbytheproductionofdocuments,thedocuments must be—(a)containedtogether,andarranged,inawaythatmakesthedocumentsreadilyaccessibleto,andcapableofconvenientinspection by,
the party to whom the documents are produced;
200Rules of the Supreme Courtand(b)identifiedinawaythatenablesparticulardocumentstoberetrieved
readily on later occasions.(2)If disclosure is
effected by the production of documents, the partyproducing the documents for inspection
must—(a)providefacilities(includingmechanicalandcomputerisedfacilities) for
the inspection and copying of the documents; and(b)make available a person who is able
to—(i)explain the way the documents are
arranged; and(ii)assistinlocatingandidentifyingparticulardocumentsorclasses of documents.(3)If disclosure is effected by the
production of documents, the mode ofarrangement of
the documents when in use—(a)mustnotbedisturbedmorethanisnecessarytoachievesubstantial
compliance with subrule (1)(a); and(b)if
the party to whom the documents are produced for inspectionso
requires—must not be disturbed at all.(4)If
disclosure is effected by the delivery of copies of documents,
theparty delivering the copies must provide a
list with the copies—(a)describing the
nature of each document; and(b)identifying the person by whom the document
is made.(5)The person made available under
subrule (2) by a party producingdocumentsforinspectionmust,ifrequiredbythepersoninspectingthedocuments—(a)explain to the person the way the documents
are arranged; and(b)assist the person to locate and
identify particular documents orclasses of
documents.(6)For the purposes of subrule
(1)—(a)thecontainmentofthedocumentsmaybeeffectedbyfiles,folders or
another way; and(b)the arrangement of the documents may
be effected—
201Rules of the Supreme Court(i)according to topic, class, category or
allegation in issue; or(ii)by an order or
sequence; or(iii)in another way;
and(c)the identification of the documents
may be effected by a number,description or
another way.˙Costs11.Subject to rule 12, a party who does not
make use of the opportunityto inspect
documents in accordance with a notice under rule 9 is not
entitled,without an order of the Court or a Judge, to
inspect the documents exceptontenderinganamountforthereasonablecostsofprovidinganotheropportunity for inspection.˙Deferral of disclosure12.(1)A party may give
a written notice to another party stating thatdocuments
relating to a specified question or class are not to be disclosed
tothe first party until requested by the party
at a time that is reasonable havingregard to the
stage of the proceeding.(2)The party to
whom the notice is given may disclose to the other partya
document to which the notice relates only if the other party
requests itsdisclosure.(3)A
party may disclose to another party a document relating only
todamages only if the other party requests its
disclosure.˙Inspection of documents mentioned in
pleadings or affidavits13.Apartymay,bywrittennotice,requireanotherpartyinwhosepleadings,
particulars or affidavits mention is made of a document—(a)to produce the document for the
inspection of the party makingthe requirement
or the solicitor for the party; and(b)to
permit copies of the document to be made.
202Rules of the Supreme Court˙Court orders relating to
disclosure14.(1)TheCourtoraJudgemayorderapartytoanyproceedingtodisclose to another party a document or class
of documents by—(a)delivering to the other party in
accordance with this order a copyof the document,
or of each document in the class; or(b)producing for the inspection of the other
party in accordance withthis order the document, or each
document in the class.(2)The Court or a
Judge may order a party to any proceeding to file andserve
on another party an affidavit—(a)deposing that a specified document or class
of documents doesnot exist or has never existed; or(b)deposing to the circumstances in which
a specified document orclass of documents—(i)ceased to exist; or(ii)passed out of
the possession or control of the first party.(3)TheCourtoraJudgemayorderthatdelivery,productionorinspectionofadocumentorclassofdocumentsforthepurposesofdisclosure—(a)be
provided; or(b)not be provided; or(c)be deferred.(4)An
order mentioned in subrule (1) or (2) may be made only if—(a)there are special circumstances and
the interests of justice requireit; or(b)it appears there is an objective
likelihood that—(i)the duty to disclose has not been
complied with; or(ii)a specified
document or class of documents exists or existedand
has passed out of the possession or control of a party.(5)An order mentioned in subrule (3) may
be made subject to conditionsthat the Court or
Judge considers just.(6)If, on an
application for an order under this rule, objection is made
to
203Rules of the Supreme Courtthe
disclosure of a document (whether on the ground of privilege or
anotherground),theCourtoraJudgemayinspectthedocumenttodecidethevalidity of the objection.˙Relief from duty to disclose15.(1)The Court or a
Judge may order that a party be relieved, wholly orto a
specified extent, of the duty of disclosure.(2)In
determining whether to make the order, the matters to which
theCourt or Judge may have regard include the
following—(a)the likely time, cost and
inconvenience involved in disclosing thedocuments or
classes of documents compared with the amountinvolved in the
action;(b)the relative importance of the
question to which the documents orclasses of
documents relate;(c)the probable effect on the outcome of
the action of disclosing ornot disclosing
the documents or classes of documents.˙Consequences of non-disclosure16.If a party does not disclose a
document in accordance with this orderor a notice or
order under this order, the party—(a)may
not tender the document, or adduce evidence of its contents,without leave of the Court or a Judge at the
trial; and(b)is liable to process of contempt or
sequestration for the failure;and(c)may be ordered to pay the costs or a
part of the costs of the cause.˙Certificate by solicitor17.(1)The
solicitor having conduct of a cause on behalf of a party
mustgive to the Court or a Judge at the trial, a
certificate—(a)stating that the duty of disclosure
has been explained fully to theparty;
and(b)ifthepartyisacorporation—identifyingtheindividualor
204Rules of the Supreme Courtindividuals to whom the duty was
explained.(2)The certificate must be—(a)given at or immediately before the
trial; and(b)signed by the solicitor; and(c)addressed to the Court.˙Production of documents at trial18.(1)Documents
disclosed under this order must be produced at thetrial
if—(a)noticetoproducethemhasbeengivenwithreasonableparticularity;
and(b)their production is asked for at the
trial.(2)If a document disclosed under this
order is tendered at the trial, it isadmissible in
evidence against the disclosing party as relevant and as
beingwhat it purports to be.†2.
Interrogatories˙Entitlement to deliver
interrogatories19.Interrogatories may be delivered only
in accordance with this order.˙Delivery of interrogatories20.(1)By leave of the
Court or a Judge, interrogatories may, at any time,and
on such terms as may be ordered as to costs, be delivered
to—(a)a party to a cause; or(b)a person whom it is necessary to
identify for the purpose of acause it is
proposed to start.(2)The number of interrogatories may be
more than 30 only if the Courtor a Judge
directs that a greater number may be delivered.
205Rules of the Supreme Court(3)The number of interrogatories is to be
determined by treating eachdistinct question
as 1 interrogatory.˙Granting of leave to deliver
interrogatories21.(1)SubjecttoanorderoftheCourtoraJudge,leavetodeliverinterrogatories
may be granted—(a)on application without notice to any
other person; and(b)only if the Court or Judge is
satisfied there is not likely to beavailable to the
applicant at the trial any other reasonably simpleand
inexpensive way of proving the matter sought to be elicitedby
interrogatory.(2)The application must be accompanied by
a draft of the interrogatoriesintended to be
delivered, unless the Court or Judge otherwise directs.˙Answering interrogatories22.(1)Subjecttothisorder,apersontowhominterrogatoriesaredelivered is required to answer them.(2)The person must answer the
interrogatories—(a)within the time ordered by the Court
or Judge; and(b)by delivering to the interrogating
party—(i)a statement in answer to the
interrogatories; and(ii)an affidavit
verifying the statement.(3)If a
party—(a)claims relief against 2 or more other
parties; and(b)delivers interrogatories to 1 or more
of them;the statement and affidavit also must be
delivered to each party who entersan
appearance.˙Statement in answer to
interrogatories23.(1)The statement in
answer to interrogatories must comply with this
206Rules of the Supreme Courtrule,
unless the Court or a Judge otherwise orders.(2)The
statement must deal with each interrogatory specifically—(a)by answering the substance of the
interrogatory; or(b)by objecting to answer the
interrogatory.(3)An answer must be given directly and
without evasion or resort totechnicality.(4)An
objection must be made by—(a)specifying the
grounds of the objection; and(b)briefly stating the facts on which the
objection is made.(5)The statement is not required to deal
with an interrogatory to whichan order under
rule 25(a) applies.(6)The statement is required to deal with
an interrogatory to which anorder under rule
25(b) applies only to the extent required by the order.˙Grounds for objection to answering
interrogatories24.(1)The following
are the only grounds on which a person may objectto
answering an interrogatory—(a)the
interrogatory does not relate to a matter in question, or
likelyto be in question, between the person and
the interrogating party;(b)the
interrogatory is vexatious or oppressive;(c)privilege.(2)The
Court or a Judge may—(a)requirethegroundsofobjectionspecifiedinastatementinanswer to interrogatories to be
specified with greater particularity;and(b)determine the sufficiency of the
objection.(3)If the objection is determined to be
sufficient, the interrogatory is notrequired to be
answered.
207Rules of the Supreme Court˙Unnecessary interrogatories25.On an application made to the Court or
a Judge, the Court or Judgemay—(a)order that a person is not required to
answer an interrogatory; or(b)byorder,limittheextenttowhichthepersonisrequiredtoanswer an interrogatory.˙Identity of individual by whom verifying
affidavit to be made26.(1)Subject to
subrule (2), the affidavit verifying the statement of aperson in answer to interrogatories must be
made—(a)by the person; or(b)if
the person is under disability—by the guardian or committee
ofthe person; or(c)if
the person is a corporation or organisation—(i)by a
member or officer of the corporation or organisation; or(ii)byanotherindividualinvolvedinthemanagementofitsaffairs; or(d)if
the person is a body of persons lawfully suing or being sued
inthenameofthebodyorinthenameofanofficerorotherperson—by a
member or officer of the body; or(e)if
the person is a State, a Territory or the Commonwealth or anofficerofaState,aTerritoryortheCommonwealthsuingorbeingsuedinanofficialcapacity—byanofficeroftheState,Territory or
Commonwealth.(2)If the person is a person to whom
subrule (1)(c), (d) or (e) applies—(a)theCourtoraJudgemay,inrelationtoalloranyoftheinterrogatories—(i)specify (by name or otherwise) the
individual to make theaffidavit; or(ii)specify (by description or otherwise) the
individuals fromwhom the interrogating party may choose the
individual tomake the affidavit; and
208Rules of the Supreme Court(b)the affidavit must be made in relation
to the interrogatories, or therelevant
interrogatories, by—(i)the individual
specified; or(ii)the individual
chosen by the interrogating party.(3)Subjecttosubrule(2),ifthepersonisapersontowhomsubrule (1)(c),
(d) or (e) applies—(a)theinterrogatingpartymustspecifyintheinterrogatories,inrelation to each interrogatory, the
individual to make the affidavit;and(b)the affidavit must be made, in
relation to an interrogatory, by theindividual
specified.(4)Theindividualspecifiedundersubrule(3)mustbeapersonwhoreasonably may be supposed—(a)to be qualified to make the affidavit
under the relevant paragraphof subrule (1);
and(b)to have knowledge of the relevant
facts.˙Failure to answer interrogatory27.(1)This rule
applies if a person does not give an answer, or gives aninsufficient answer, to an
interrogatory.(2)If this rule applies, the Court or a
Judge may—(a)order that an answer or further answer
be given under rule 22; or(b)order the person
to attend to be orally examined; or(c)if
the person is not qualified to make the affidavit verifying
thestatement in answer to the
interrogatories—order an individualwhoisqualifiedtomaketheaffidavittoattendtobeorallyexamined.(3)This rule does not limit the powers of
the Court under rule 28.˙Failure to comply
with Court order28.(1)If a person does
not comply with an order under rule 27(2)(a), the
209Rules of the Supreme Courtinterrogating party or another party may
apply on notice to the Court or aJudge for—(a)an order that the cause be stayed or
dismissed as to the whole or apart of the
relief being claimed; or(b)judgment or an
order against the person; or(c)an
order that the relevant statement in answer to interrogatories
oraffidavit verifying the statement be filed
or served within the timespecified in the order.(2)TheCourtoraJudgemaymakeanorderundersubrule(1),oranother order, specifying consequences
for failing to comply with the orderthat the Court or
Judge considers appropriate.(3)This
rule does not limit the powers of the Court or a Judge to
punishfor contempt of court.˙Tendering answers29.(1)A
party may tender as evidence—(a)an
answer of another party to an interrogatory without
tenderingother answers; or(b)partofananswerofanotherpartytoaninterrogatorywithouttendering all of the answer.(2)If the whole or a part of an answer to
an interrogatory is tendered asevidence, the
Court or a Judge may—(a)consider all of
the answers; and(b)subject to subrule (3), reject the
tender, unless another answer orpart of an
answer is tendered also.(3)The Court or
Judge may reject the tender on the condition mentionedinsubrule(2)(b)onlyifitappearstotheCourtorJudgethattheotheranswer or part of
an answer is so connected with the matter tendered thatthe
matter should not be used without the other answer or
part.
210Rules of the Supreme Court†3. General˙Public
interest considerations30.This order does
not affect any rule of law that authorises or requiresthe
withholding of any matter on the ground that its disclosure would
beinjurious to the public interest.˙Service on solicitors of disclosure
orders31.(1)If an order
relating to interrogatories or the delivery, production orinspectionofdocumentsisservedonthesolicitorforthepartyagainstwhom
the order is made, the service is sufficient service for making
anapplication for contempt of court for
disobedience to the order.(2)If—(a)an application of a kind mentioned in
subrule (1) is made; and(b)the order to
which the application relates was served in the waymentioned in the subrule;thepartyagainstwhomtheorderismademayshowinanswertotheapplication that the party has no
notice or knowledge of the order.˙Attachment of solicitor32.If—(a)an order
mentioned in rule 31 is served on the solicitor for theparty against whom the order is made;
and(b)the solicitor fails, without
reasonable excuse, to give notice of theorder to the
party;the solicitor is liable to a proceeding for
contempt of court.˙Costs33.If,inanycase,thecostofcomplyingwiththisorderwouldbeoppressive to a party, the Court or a Judge
may order that another party—
211Rules of the Supreme Court(a)pay or contribute to the cost of
compliance; or(b)provide security for the cost.˙Right to disclosure34.The
right of a party to a cause to discovery is limited to
obtainingdisclosure, inspection and interrogatories
under this order.†4. Transitional˙Proceedings already commenced35.Order 35, as in force immediately
before the commencement of thisrule, continues
to apply to a cause in which an affidavit of documents wasfiled
before the commencement.†ORDER
36—ADMISSIONS—NOTICES TO PRODUCE˙Notice
of admission of facts1.Anypartytoacausemaygivenotice,bytheparty’spleading,orotherwise in writing, that the party admits
the truth of the whole or any partof the case of
any other party.˙Notice to admit facts or
documents—costs of refusal or neglect toadmit2.(1)Any party to a
cause may, by notice in writing, call upon any otherparty
to admit any specific fact, or any document, saving all just
exceptions;and, in case of refusal or neglect to admit
after such notice, the costs ofproving any such
fact or document shall be paid by the party so neglectingor
refusing, whatever the result of the cause may be, unless at the
trial orhearing the Court or Judge certifies that the
refusal to admit was reasonable;and no costs of
proving any document shall be allowed unless such noticeis
given, unless the omission to give the notice is, in the opinion of
the
212Rules of the Supreme Courttaxing officer, a saving of expense.(2)However, any admission made in
pursuance of such notice shall bedeemed to be made
only for the purposes of the particular cause or issue,andshallnotbeusedasanadmissionagainstthepartyonanyotheroccasion, or in
favour of any person other than the party giving the notice.(3)In addition, the Court or a Judge may
at any time allow any party toamend or withdraw
any admission so made on such terms as may be just.˙Form of notice and admission3.Notices to admit documents and facts,
and admission of facts, shall beintheformsinschedule1,withsuchvariationsascircumstancesmayrequire.˙Notice
under the Evidence Act 1977, s 634.A
notice of intention to adduce in evidence as proof of the execution
ofa will, codicil, deed, or instrument in
writing, a declaration under theOathsAct
1867made by an attesting witness or any other
person, shall specify thename of the person by whom the
declaration is made, and shall be given notless than 10 days
before the day on which the cause or issue is appointed tobe
tried.˙Judgment or order upon admissions of
facts5.When admissions of fact have been made
in a cause, either on thepleadings or otherwise, any party may,
at any stage of the cause, apply tothe Court or a
Judge for such judgment or order as upon such admissionsthe
party may be entitled to, without waiting for the determination of
anyother question between the parties; and the
Court or a Judge may, uponsuch application, make such order, or
give such judgment, as may be just.˙Affidavit of signature to admissions6.An affidavit made by the solicitor, or
the solicitor’s clerk, of the duesignatureofanyadmissionsmadeinpursuanceofanoticetoadmitdocuments or
facts, shall be sufficient evidence of such
admissions.
213Rules of the Supreme Court˙Notice to produce documents7.(1)A notice to
produce documents at a trial or other hearing of anycause
or matter shall be in the form in schedule 1, with such variations
ascircumstances may require.(2)Anaffidavitmadebythesolicitor,orthesolicitor’sclerk,oftheservice of any
notice to produce, and of the time when it was served, with
acopy of the notice served, shall be
sufficient evidence of the service of thenotice, and of
the time when it was served.†ORDER 37—ISSUES, INQUIRIES AND
ACCOUNTS˙Issues may be prepared and
settled1.When in any cause it appears to the
Court or a Judge that the issues offact in dispute
are not sufficiently defined, the parties may be directed toprepare issues, and such issues shall, if the
parties differ, be settled by theCourt or a
Judge.˙Inquiries and accounts when
directed5.The Court or a Judge may, at any stage
of the proceedings in a causeor matter, direct
any necessary inquiries or accounts to be made or taken,notwithstanding that it may appear that there
is some special or further reliefsought for or
some special issue to be tried, as to which it may be properthat
the cause or matter should proceed in the ordinary
manner.
214Rules of the Supreme Court†ORDER 38—QUESTIONS OF LAW AND
ISSUESWITHOUT PLEADINGS†1.
Questions of law˙Special case by consent1.(1)The parties to
any cause may concur in stating the questions of lawarising therein in the form of a special case
for the opinion of the Court.(2)Every such special case shall be divided
into paragraphs numberedconsecutively, and shall concisely
state such facts and documents as may benecessary to
enable the Court to decide the questions raised thereby.(3)Upon the argument of the case the
Court and the parties shall be atliberty to refer
to the whole contents of any documents referred to therein,and
the Court shall be at liberty to draw from the facts and documents
statedin the case any inference, whether of fact or
law, which might have beendrawn therefrom if they had been proved
at a trial.˙Special case by order before
trial2.If in any cause it is made to appear
to the Court or a Judge that there isany question of
law which it would be convenient to have decided beforeany
evidence is given or any question or issue of fact is tried, or
before anyreference is made to a referee or an
arbitrator, the Court or Judge may makean order
accordingly, and may direct such question of law to be raised
forthe opinion of the Court, either by special
case or in such other manner asthe Court or
Judge may deem expedient; and all such further proceedings
asthedecisionofsuchquestionoflawmayrenderunnecessarymaythereupon be stayed.˙Special case to be filed3.Everyspecialcaseshallbesignedbytheseveralpartiesortheirsolicitors, and
shall be filed by the plaintiff.
215Rules of the Supreme Court˙Leave to set down where infant, or
mentally ill person is a party4.A
special case in any cause to which an infant, or a mentally ill
personwho has not been so declared, or for whom a
committee of the person orestate, as the case may be, has not
been appointed, is a party, shall not be setdown for argument
without leave of the Court or a Judge, the applicationforwhichmustbesupportedbysufficientevidenceonoaththatthestatementscontainedinsuchspecialcase,sofarasthesameaffecttheinterest of such infant, or mentally
ill person, are true.˙Agreement as to
payment of money and costs5.The parties to a
special case may sign a memorandum to the effectthat,
on the judgment of the Court being given in the affirmative or
negativeof any question of law raised by the case, a
sum of money, fixed by theparties, or to be ascertained by the
Court, or in such manner as the Courtmay direct, shall
be paid by 1 of the parties to the other of them, either
withor without the costs of the cause; and the
judgment of the Court may beentered for the
sum so agreed or ascertained, with or without costs, andexecutionmayissueuponsuchjudgmentforthwith,unlessotherwiseagreed, or unless
stayed on appeal.˙Form of entry for argument6.Either party may enter a special case
for argument by delivering to theproper officer a
memorandum of entry, in the form in schedule 1, and, if aninfant, or any such mentally ill person as
mentioned in rule 4, is a party tothe cause,
producing a copy of the order giving leave to enter the same
forargument.˙Special case may be heard before Court of
Appeal in the first instance7.When
the party entering a special case for argument enters it to
beheardbeforeasingleJudge,andanyotherpartyrequiresittobeheardbefore the Court
of Appeal in the first instance, the other party must,
within4 days after receiving notice that the case
has been so entered, deliver to theregistrar and to
the opposite party a memorandum in the form in schedule 1or to
the like effect, and the special case shall thereupon be deemed to
havebeen entered to be heard before the Court of
Appeal in the first instance.
216Rules of the Supreme Court˙Copies for Judges9.Four
days at least before the day for which a special case is set
downfor argument the party setting it down shall
leave a copy of the case at thechambers of the
Judge, or at the chambers of each of the Judges who are tosit
on the hearing of the argument.˙Application of order10.This
order applies to every special case stated in a cause.˙No special case under Equity Act
186711.No special case shall hereafter be
stated under theEquity Act 1867.†2. Issues of fact without
pleadings˙Trial of questions of fact agreed
upon12.(1)If the parties
to a cause agree as to any question or questions offact
to be decided between them, they may, at any time before judgment,
byconsent and by order of the Court or a Judge,
proceed to the trial of suchquestion or
questions of fact without formal pleadings.(2)Any
such question may be stated for trial in the form in schedule
1,with such variations as circumstances may
require; and such questions maybeenteredfortrialandtriedinthesamemannerasissuesjoineduponpleadings in an
action, and the proceedings thereon shall be subject to thesamecontrolbytheCourtoraJudgeaswhenissueisjoineduponpleadings.˙Order
for payment of sum of money13.The Court or a
Judge may by consent of the parties order that, uponthe
finding in the affirmative or negative of any such question as in
rule 12mentioned, a sum of money, fixed by the
parties, or to be ascertained upona question stated
for that purpose, shall be paid by 1 of the parties to theother
of them, either with or without the costs of the
cause.
217Rules of the Supreme Court˙Entry of judgment upon the
finding14.Uponthefindingonanysuchquestionasinrules12and13mentioned, judgment may be entered for any
sum so agreed or ascertainedas aforesaid, or
for any other relief to which the finding shows either partyto be
entitled, with or without costs, as the case may be, and execution
mayissue upon such judgment forthwith, unless
otherwise agreed, or unless theCourt or a Judge
otherwise orders for the purpose of giving either party anopportunity of moving to set aside the
finding or for a new trial.˙Record
of proceedings15.The proceedings upon any such issue as
aforesaid may be recorded atthe instance of
either party, and the judgment, whether actually recorded ornot,
shall have the same effect as any other judgment in a contested
action.†ORDER 39—TRIAL†1.
Place˙Place of trial1.(1)The
plaintiff may in the endorsement on the plaintiff’s writ, or
intheplaintiff’sstatementofclaim,nametheplacewheretheplaintiffproposes that the
action shall be tried, and the action shall, unless the
Courtor a Judge otherwise orders, be tried in the
place so named.(2)When no place of trial is named, the
place of trial shall, unless theCourt or a Judge
otherwise orders, be Brisbane, Rockhampton, Townsvilleor
Cairns, according to the district in which the cause of action
arose.(3)This rule shall not apply to actions
commenced under order 95.
218Rules of the Supreme Court†2. Mode of trial˙Trial
by jury4.(1)Subject to the
provisions of rules 5 to 13, and to the provisions ofany
Act requiring the action to be tried without a jury, the plaintiff
may inthe plaintiff’s statement of claim, and any
defendant may, in the defendant’sdefence, require
that the issues of fact shall be tried by a Judge with a
juryand thereupon the same shall be so
tried.(2)Subject to rules 5 to 13, where a
defendant by a counterclaim raisesnew issues of
fact, the plaintiff may in the plaintiff’s answer require
theissues of fact to be tried by a Judge with a
jury and thereupon the same shallbe so
tried.˙Trial by Judge5.When
neither the plaintiff nor the defendant requires the issues of
factto be tried by a Judge with a jury under the
provisions of rule 4, the sameshallbetriedbyaJudgewithoutajury,unlesstheCourtoraJudgeotherwise
orders.˙Mode of trial in admiralty
actions6.(1)Admiralty
actions shall be tried by a Judge without a jury, unlessthe
Court or a Judge otherwise orders.(2)At
the trial the Court may pronounce for the claim with or without
areference to the registrar or to the
registrar assisted by merchants.˙Causes
not formerly triable without jury may be tried by Judge andassessors, or referee7.SubjecttosuchrightasexistedatthecommencementoftheJudicature Act 1867to have
particular cases submitted to the verdict of ajury, and subject
to the like right under any later statute, the Court or
Judgemay at any time direct the trial of any
question or issues of fact, or partly offact and partly
of law, arising in any cause or matter to be tried without
a
219Rules of the Supreme Courtjury,
either by a Judge or by a Judge with assessors, or may refer the
samefor inquiry and report to a special
referee.˙Issue requiring prolonged examination
of documents etc.8.The Court or a Judge may direct the
trial without a jury of any cause,matter,orissuerequiringanyprolongedexaminationofdocumentsoraccounts, or any scientific or local
investigation, which cannot in their, hisor her opinion
conveniently be made with a jury or conducted by the Courtthrough its ordinary officers.˙Changing mode of trial9.In any case in which neither party has
given notice under rules 4 to 8that the party
desires to have the issues of fact tried before a Judge with
ajury, and in any case within theJudicature Act 1867, section 12 in
which theplaintiff or any defendant desires to have
the action tried in any other modethan that
specified in the notice of trial, he or she must apply to the Court
ora Judge for an order to that effect within 4
days after service of the notice oftrial, or within
such extended time as the Court or a Judge may allow.˙Court may direct trial with jury at any
time10.If in any cause or matter it appears
to the Court or a Judge eitherbefore or at the
trial that any issue of fact could be more conveniently
triedbefore a Judge with a jury, the Court or
Judge may direct that it shall be sotried, and may
for that purpose vary any previous order.˙Jury
of 4 unless otherwise stated11.A
notice of trial before a Judge with a jury shall, unless
otherwisestated, be deemed to be for trial before a
jury of 4 persons, as provided bytheJuryAct1929,section18,andtheJuryActAmendmentAct1934,section 3.˙Trying
of questions in different ways and at different times12.(1)In this
rule—
220Rules of the Supreme Court“question”means a question
or issue, whether of fact or law, or partly offact and partly
of law, that arises in a proceeding (whether or not thequestion or issue is raised by the pleadings
or by the agreement of theparties to the proceeding).(2)A Judge may at any time make an order
providing for—(a)a question to be tried separately;
or(b)when, in relation to the rest of the
proceeding, a question that is tobe tried
separately is to be tried; or(c)how
a question that is to be tried separately is to be tried; or(d)where a question that is to be tried
separately is to be tried; or(e)the
amendment of an order made under this subrule.(3)If a
question has been tried separately under this rule, a Judge
maymakeanorderorgiveadirectionthatisappropriate,includingforexample—(a)dismissing the proceeding, or the whole or a
part of a claim forrelief that is a part of the proceeding;
or(b)giving judgment in the
proceeding.(4)However, if an assessment of damages
is made, it must be on a finalbasis for the
proceeding.(5)Except with leave of the Court of
Appeal, an appeal does not lie froman order made or
a direction given under subrule (3) unless the order ordirection disposes of the proceeding.˙Trial to be before single Judge, unless
specially ordered13.Every trial of a question or issue of
fact with a jury shall be heldbefore a single
Judge, unless such trial is specially ordered to be held
before2 or more Judges.
221Rules of the Supreme Court†3. Notice and entry of trial˙Notice of trial by plaintiff14.(1)Notice of trial
may be given in any cause or matter by the plaintiffor
other party in the position of plaintiff.(2)Such
notice may be given with the reply (if any); or, in other
thanadmiralty actions, where no order for a reply
has been made under order 27,rule1,ontheexpirationof4daysafterthedefence,orthelastofthedefences shall have been delivered; or
at any time after the issues of fact areready for
trial.˙Notice of trial by defendant—motion to
dismiss for want ofprosecution15.If
the plaintiff does not give notice of trial within 6 weeks after
theplaintiff is first entitled to do so, or
within the like period after a new trial isordered,or,ineithercase,withinsuchextendedtimeastheCourtoraJudge may allow, any defendant may,
before notice of trial given by theplaintiff, give
notice of trial, or may apply to the Court or a Judge to
dismissthe action for want of prosecution; and on
the hearing of such applicationthe Court or a
Judge may order the action to be dismissed accordingly, ormay
make such other order, and on such terms, as to the Court or
Judgemay seem just.˙Form
of notice of trial16.(1)The notice of
trial shall state whether it is for the trial of the causeor of
questions or issues therein, and shall name the place where, and
thesittings at which, the trial is to be
had.(2)Thenoticeshallbeinoneoftheformsinschedule1,withsuchvariations as circumstances may
require.˙Length of notice17.(1)Ten
days notice of trial shall be given when the party to whom it
isgivenresideswithin320kmofBrisbane,Rockhampton,Townsvilleor
222Rules of the Supreme CourtCairns,asthecasemaybe,accordingasthecauseispendingintheSupreme Court at Brisbane, or in the
Central Court, Northern Court or FarNorthern Court,
and 16 days notice in any other case, unless, in either
case,the party to whom it is given has consented,
or is under terms, to take shortnoticeoftrial;andsuchnoticeshallbesufficientinallcases,unlessotherwise ordered by the Court or a
Judge.(2)Short notice of trial shall be half
the number of days for full notice,less 1, unless
otherwise ordered.˙Entry of cause for trial18.Noticeoftrialshallbegivenonorbeforeenteringthecauseorquestions or issues for trial; and a cause
may be entered for trial, providedthat notice of
trial has been given.˙Avoidance of
notice of trial19.The entry must be made within 6 days
after notice of trial is given;otherwise the
notice of trial shall cease to have effect.˙Notice
of trial at Brisbane, Rockhampton, Townsville or Cairns20.Notice of trial of a cause or
questions or issues before a Judge with ajury at Brisbane,
Rockhampton, Townsville or Cairns shall be for the firstday
of the sittings, unless the Court or a Judge allows it to be given
for alater day.˙Notice
of trial in the country21.NoticeoftrialatanyplaceotherthanBrisbane,Rockhampton,Townsville or
Cairns shall be for the first day of the then next civil
sittingsat the place for which notice of trial is
given.˙Countermanding notice22.A notice of trial shall not be
countermanded except by consent, or byleave of the
Court or a Judge, which leave may be given subject to suchterms
as to costs, or otherwise, as may be just.
223Rules of the Supreme Court˙Entry for trial by party served with
notice23.If the party giving notice of trial
omits to enter the cause or issues fortrial on the day
or the day after giving notice of trial, the party to whomnotice has been given may, within 4 days
thereafter, enter the same for trial,unless in the
meantime the notice has been countermanded under rule 22.˙Trial24.When
notice of trial of a cause or questions or issues is given for
anyappointed civil sittings of the Court, the
cause or questions or issues may,subject to rule
30A, be tried at that sittings or at any later date for which
thetrial is fixed.˙Power
to certify for speedy trial24A.(1)Onthehearingofasummonsunderorder18,oranyadjournment
thereof, or of a summons for directions or any adjournmentthereof, or of any application on notice
thereunder or of any summons, itshall be lawful
for the Court or Judge, if it appears that the action,
cause,issue, or matter is one which ought to be
tried at any early date, to certifythat the same
should be tried speedily and to fix the mode of trial.(2)If the Court or Judge so certifies
either party may apply to a Judge tofix an early date
for the trial of such action, cause, issue, or matter, and
suchJudge may, if in his or her discretion the
Judge thinks fit so to do, dispensewith any notice
of trial or any certificate of readiness for trial and fix the
dateand place of trial, or direct that the trial
be expedited and the action, cause,issue, or matter
placed in the list for trial in such position as the Judge
maythink fit.˙Trial
in default of appearance in admiralty actions26.(1)Inanadmiraltyaction,ifnoappearancehasbeenentered,theplaintiff may, at any time after the
time limited for appearance, enter theaction for trial
on obtaining from the Judge leave to proceed ex parte.(2)In an action in rem, a certificate of
service of the warrant to arrest, or,in the case of an
action against proceeds in Court, an affidavit of service
of
224Rules of the Supreme Courtthe
writ upon the registrar and of entry of a caveat payment, must be
filedbefore the leave is applied for.˙In default of pleading in admiralty
actions27.In an admiralty action, if an
appearance has been entered, either partymay give notice
of trial and enter the action for trial as soon as the lastpleading has been delivered, or as soon as
the time allowed to the oppositeparty for
delivering any pleading has expired without such pleading
havingbeen delivered.˙In
case of accounts in admiralty actions28.In
an admiralty action, if the writ of summons has been
endorsedwith a claim to have an account taken, or if
the liability has been admitted ordetermined,andthequestionissimplyastotheamountdue,theJudgemay, on the
application of either party, fix a time within which the
accountsand vouchers, and the proofs in support
thereof, shall be filed, and at theexpiration of
that time either party may give notice of trial and enter
theaction for trial.˙Setting down causes for further
consideration29.(1)Whenacauseormatterhasbeenadjournedforfurtherconsideration,
the same may, after the expiration of 8 days from the filingof
the registrar’s certificate, be set down for further consideration,
on thewrittenrequestoftheplaintifforpartyhavingtheconductoftheproceedings, or his or her solicitor;
and after the expiration of 14 days fromthefilingofthecertificatethecauseormattermaybesetdownonthewritten request
of the defendant or any other party, or his or her
solicitor.(2)The request shall be in the form in
schedule 1.(3)Notice of the setting down and of the
day for which the cause ormatter is set down shall be given to
the other parties in the action 6 days atleast before the
day for which it is set down.(4)Such
notice shall be in the form in schedule 1.
225Rules of the Supreme Court†3A. Personal injury and death˙Application29A.(1)This
division applies to actions for damages for personal injuryor
death.(2)This division takes effect subject to
rule 30A.˙Setting down for trial29B.An action to
which this division applies shall not be allocated a trialdate—(a)unless all parties have complied with this
division; or(b)the party seeking to have a trial date
allocated for the action hascomplied with
this division and has given written notice to allotherpartiesandtheCourtthatfurthercompliancewiththisdivision is
waived.˙Plaintiff’s statement of loss and
damage29C.(1)The plaintiff
shall, within 28 days after the close of pleadings,fileandserveonthedefendantawrittenstatementoflossanddamagedisclosing—(a)particulars of any amount claimed for
out-of-pocket expenses andlistingalldocumentsintheplaintiff’spossessionorpowerconcerning those
expenses;(b)if there is a claim for economic
loss—(i)the name and address of each of the
plaintiff’s employersduring the 3 years immediately before
the injury, the periodof employment and the capacity in
which the plaintiff wasemployed by each employer and the
plaintiff’s net earningsfor each period of employment;(ii)the name and
address of each of the plaintiff’s employerssincetheinjury,theperiodofemploymentbyeachemployer, the
capacity in which the plaintiff was employed
226Rules of the Supreme Courtandtheplaintiff’snetearningsforeachperiodofemployment;(iii)particulars of any amount the plaintiff is
claiming for loss ofincome to the date of the
statement;(iv)particularsofanydisabilityresultinginlossofearningcapacityandoftheamountofanyfutureeconomiclossclaimed;
and,(v)in the case of a self-employed
plaintiff, such additional orother
particulars as will disclose the basis of the claim foreconomic loss;(c)particulars of the pain and suffering
experienced by the plaintiffandthelossofamenitiescausedbytheinjuries,includingparticulars of
the physical, social and recreational consequences ofthe
injuries sustained;(d)particulars of any other amount sought
as damages not otherwisementioned;(e)the
names and addresses of all hospitals, doctors, other expertsandallotherpersonswhohaveexaminedtheplaintifforwhohavegivenreportsontheplaintiff’sinjury,loss(includingeconomic loss)
and treatment;(f)all documents in the plaintiff’s
possession or power relating to theplaintiff’sinjury,loss(includingeconomicloss)andtreatmentand without
limiting the generality of the plaintiff’s obligation thestatement shall disclose—(i)hospital and medical reports;
and(ii)hospital,
medical and similar accounts; and(iii)documents(ifany)concerningtherefundofworkers’compensationpayments,socialsecuritybenefitsoranysimilar payments; and(iv)documentsconcerningtheamountofwagespaidtotheplaintiff, or if
the plaintiff was self-employed, the loss of netincome for any period mentioned in paragraph
(b); and(v)documents concerning the tax paid by
the plaintiff and thetaxable income of the plaintiff for
any period mentioned in
227Rules of the Supreme Courtparagraph (b); and(vi)documents concerning any other head of the
plaintiff’s claimfor damages.(2)The
plaintiff shall on request and at a reasonable charge supply to
thedefendant a copy of any document mentioned in
the plaintiff’s statement ofloss and
damage.(3)Iftheplaintiffproposestorelyatthetrialonevidenceastotheplaintiff’sinjury,loss(includingeconomicloss)ortreatment(includingfuture treatment)
not in a report which if it were in a report would be liableto be
disclosed under subrule (1) the plaintiff shall before the
call-over atwhich a trial date is allocated serve on the
defendant a report or a proof ofthat
evidence.(4)Evidence which has not been disclosed
or supplied to the defendantas required by
subrule (1), (2) or (3) shall not be called or tendered at
thetrial(exceptbyconsentorincross-examination)unlesstheCourt,forspecial reason, gives leave.(5)The plaintiff shall file and serve
supplements to the statement of lossand
damage—(a)whenever there is a significant change
in the information given inthestatementoflossanddamagesafterthemakingofthestatement; and(b)so
that the statement is accurate at the time of the holding of
thecall-over at which a trial date is
allocated; and(c)so that after the allocation of a
trial date the statement is accurate atall
times.˙Defendant’s expert and economic
evidence29D.(1)The defendant
shall within 28 days after being served with theplaintiff’s statement of loss and damage file
and serve on the plaintiff awritten statement
of expert and economic evidence disclosing the namesand
addresses of all of the hospitals, doctors, and other experts who
havegiventhedefendantreportsontheplaintiff’sinjury,loss(includingeconomicloss)andtreatmentandwithoutlimitingthegeneralityofthedefendant’s obligation the statement
shall disclose—
228Rules of the Supreme Court(a)hospital and medical reports;
and(b)hospital, medical and similar
accounts; and(c)documents(ifany)concerningtherefundofworkers’compensation
payments, social security benefits or any similarpayments; and(d)documents concerning the amount of wages
paid to the plaintiffby the defendant during the 3 years
immediately before the dateof the
plaintiff’s injury; and(e)documents
concerning the tax paid by the plaintiff and the taxableincome of the plaintiff for the last 3 years
immediately before thedate of the plaintiff’s injury.(2)The defendant shall, on request,
supply to the plaintiff a copy of anydocument
mentioned in the defendant’s statement of expert and
economicevidence.(3)If
the defendant proposes to rely at the trial on evidence as to
theplaintiff’sinjury,loss(includingeconomicloss)ortreatment(includingfuture treatment)
not in a report which if it were in a report would be liableto be
disclosed under subrule (1) the defendant shall before the
call-over atwhich a trial date is allocated serve on the
plaintiff a report or proof of thatevidence.(4)Evidence which has not been disclosed
or supplied to the plaintiff asrequired by
subrule (1), (2) or (3) shall not be called or tendered at the
trial(except by consent or in cross-examination)
unless the Court, for specialreason, gives
leave.(5)The defendant shall file and serve
supplements to the statement ofexpert and
economic evidence—(a)whenever there is a significant change
in the information given inthestatementoflossanddamageafterthemakingofthestatement;(b)so
that the statement is accurate at the time of the holding of
thecall-over at which a trial date is
allocated; and,(c)after the allocation of a trial date
the statement is accurate at alltimes.
229Rules of the Supreme Court˙Insurers29E.(1)Aninsurerwhoisdefendinganactioninthenameofthedefendant is bound by this
division.(2)Where an insurer is defending an
action in the name of a defendantthis division
applies with respect to documents in the possession or powerof
the insurer as well as to documents in the possession or power of
thedefendant.(3)The
defendant’s statement of expert and economic evidence may bein
the form of a joint statement of documents in the possession or
power ofthe defendant and in the possession or power
of the insurer defending in thename of the
defendant and in such case the statement shall be endorsed
tothat effect.(4)If
an insurer and the defendant do not prepare a joint statement
ofexpert and economic evidence each shall file
and serve a separate statement.˙Legal
advice29F.Nothing in this
division requires a party to disclose the existence, ornature, of legal advice given to that
party.˙Pleadings29G.Compliancewiththisdivisiondoesnotrelieveapartyoftheobligation to amend a pleading where it
is necessary to do so to properlyplead that
party’s case.˙Costs29H.TheCourtmayinmakinganorderforcoststakeaccountofaparty’sfailuretocomplywiththisdivisionorofaparty’smannerofcompliance with this division.˙Interpretation29I.In
this division—“defendant”includes a
defendant by election.
230Rules of the Supreme Court†4. Papers for Judge˙Copies of pleadings etc. to be
delivered30.Thepartyenteringthecauseorquestionsorissuesfortrialshalldeliver to the proper officer 2 copies of the
whole of the pleadings (if any)(including
pleadings in any third party proceedings), and of the issues, or
ofsuch other proceedings as show the questions
for trial, 1 of which shall befor the use of
the Judge at the trial.†4A. Setting
actions down for trial˙Lists and date of
trial—readiness for trial30A.(1)Subject to the
provisions of this rule, every action entered fortrial
shall be set down in an appropriate list, to be known as a
call-over list.(2)No action shall be set down in a
call-over list, and no date shall befixed for the
trial of any action, unless—(a)a
certificate of readiness for trial in the form in schedule 1
signedbytheplaintiffandallotherpartieswhohaveenteredanappearance has been filed; or(b)the Court or a Judge has certified
that the action should be triedspeedily and has
dispensed with any certificate of readiness fortrial; or(c)by order of a Judge or registrar made
under subrules (5) and (5A)ontheapplicationofapartywhohassignedacertificateofreadiness for trial; or(d)by
order of a Judge or registrar made under subrule (9).(3)A certificate of readiness for trial
shall be deemed to be signed by aparty for the
purposes of this rule if it is signed by the party’s
solicitor.(3A)A certificate of
readiness for trial need not be signed by any plaintiffwhoseactionhasbeenwhollydiscontinuedorbyanydefendantwhosedefence has been
wholly withdrawn or struck out and shall be sufficient forthe
purposes of subrule (2)(a) notwithstanding that it is not signed by
anysuch plaintiff or defendant.
231Rules of the Supreme Court(4)Acertificateofreadinessfortrialshallnotbesignedbyapartyunless—(a)any
order or requirement by notice pursuant to order 35 for themaking of discovery by or to that party or
for the inspection ofdocuments, and any order for the
furnishing of particulars by orto that party,
has been complied with and an affidavit has beenfiled in answer to any interrogatories
delivered by or to that party;and(b)so far as the party is concerned, all
necessary interlocutory stepsin the action
(including steps to obtain discovery or inspection ofdocuments,admissions,particularsandanswerstointerrogatories) have been completed;
and(c)all the party’s necessary witnesses
are available; and(d)so far as the party is concerned, the
action is in all respects readyfor trial;
and(e)if in the action there is a claim in
respect of damages for personalinjuryordeath—aconferencebetweenallthepartiesortheirsolicitors or
counsel has been held for the purpose of discussing,and
if possible reaching agreement on, all matters in dispute in
theaction.(5)Anypartywhohassignedacertificateofreadinessfortrialmaytender the certificate to the other party or
parties for signature, and, if anyparty to whom the
certificate is tendered neglects or refuses to sign it
within21 days of the date of tender, may apply to a
Judge or registrar that theaction be set
down in a call-over list.(5A)On the making of
any such order the Judge or registrar may givesuch directions
as to the listing of the action as the Judge or registrar
thinksfit.(6)If on the
hearing of an application under subrule (5) it appears to
theJudge or registrar that a party has
unreasonably delayed signing a certificateofreadinessfortrial,then,withoutprejudicetoanyotherpowerordiscretion of the Judge or registrar, the
Judge or registrar may require thatparty to pay the
costs of the application forthwith.(7)No
party shall, without the leave of the Court or a Judge, make
anyrequest for particulars, or serve any notice
requiring discovery or inspection
232Rules of the Supreme Courtorcallinguponanypartytomakeanyadmission,ordeliveranyinterrogatory or make any interlocutory
application other than for an orderundersubrules(5)and(5A),atanytimeafterthepartyhassignedacertificate of readiness for trial, or after
the expiration of 21 days from thedateofthetenderofsuchacertificatetothepartyforsignatureinaccordance with subrule (5).(8)If the plaintiff does not sign a
certificate of readiness for trial buteveryotherpartywhohasenteredanappearancehassignedsuchacertificate, any party may apply to the
Court or a Judge to dismiss the actionfor want of
prosecution and on the hearing of such application the Court
orJudge may order the action to be dismissed
accordingly or may make suchother order and
on such terms as to the Court or Judge may seem meet.(9)Where, in an action to which subrule
(4)(e) applies, the pleadingshaveclosed,anypartymaygivetotheotherpartiesanoticeinwritingspecifying a day,
time and place for the holding of a conference for thepurpose of discussing, and if possible
reaching agreement on, all matters indispute in the
action.(9A)Ifanypartytowhomsuchnoticehasbeengivenunreasonablyneglects or
refuses to attend a conference, the Judge or registrar may, on
theapplication of any party who would be in a
position immediately to sign acertificate of
readiness for trial if such a conference had been held, give
suchdirections as to the listing of the action as
the Judge or registrar thinks fit,and may, without
prejudice to any other power or discretion of the Judge orregistrar, require the party neglecting or
refusing to attend to pay the costs ofthe application
forthwith.(10)Evidence of
anything said, or of any admission made, in the courseof a
conference for the purpose of subrule (4)(e) or subrules (9) and
(9A) isnot admissible at the trial of the
action.†5. Proceedings at trial˙Default of appearance by defendant at
trial31.If, when a cause is called on for
trial, the plaintiff appears, and thedefendant does
not appear, then the plaintiff may prove the plaintiff’s
claim,so far as the burden of proof lies upon the
plaintiff.
233Rules of the Supreme Court˙Default of appearance by
plaintiff32.If, when a cause is called on for
trial, the defendant appears, and theplaintiffdoesnotappear,thedefendant,ifthedefendanthasnocounterclaim, shall be entitled to
judgment dismissing the action, but if thedefendanthasacounterclaim,thenthedefendantmayprovesuchcounterclaim so far as the burden of proof
lies upon the defendant.˙Judgment by
default may be set aside on terms33.(1)A
verdict or judgment obtained where one party does not appear
atthe trial may be set aside by the Court or a
Judge upon such terms as maybe just.(2)If the cause was set down for trial in
the country, the application maybe made either at
the place appointed for the trial before the close of thesittings, or afterwards in Brisbane,
Rockhampton, Townsville or Cairns, asthe case may
be.˙Adjournment of trial34.A Judge may, at or before the trial,
if the Judge thinks it expedient forthe interests of
justice, postpone or adjourn a trial for such time, and to
suchplace, and upon such terms (if any) as the
Judge may think fit.˙Disallowance of
vexatious questions on cross-examination34A.TheJudgemayinallcasesdisallowanyquestionsputincross-examinationofanywitnesswhichmayappeartotheJudgetobevexatious and not relevant to any
matter proper to be inquired into in thecause or
matter.˙Nonsuit35.Whentheplaintiffatthetrialfailstoestablishbytheplaintiff’sevidence such a
case as to call for an answer from the defendant, the Courtmay
direct judgment of nonsuit to be entered.
234Rules of the Supreme Court˙Effect of judgment of nonsuit36.A judgment of nonsuit shall not have
the effect of a judgment on themerits for the
defendant.˙Judgment—further consideration37.(1)The Judge may,
at or after a trial, direct that judgment be enteredfor
any or either party, or may adjourn the case for further
consideration, ormay leave any party to move for
judgment.(2)No judgment shall be entered after a
trial without the order of theJudge before whom
the trial took place, except as provided by section 9 oftheSupreme Court Act 1892.˙Entry of findings
of fact on trial at assizes etc.38.At
every trial at civil sittings, when the officer present at the
trial isnot the officer by whom judgment ought to be
entered, the associate shallenter all such
findings of fact as the Judge may direct to be entered, and
thedirections (if any) of the Judge as to
judgment, and the certificates (if any)granted by the
Judge, in a book to be kept for the purpose.˙Endorsement for entry of judgment39.IftheJudgedirectsthatanyjudgmentbeenteredforanypartyabsolutely, the
endorsement of the associate on the filed copy pleadings tothateffectshallbeasufficientauthoritytotheproperofficertoenterjudgment
accordingly.˙Adjournment of matters not heard39A.Any cause,
question or issue entered for trial at a civil sittings oradjourned from some other civil sittings for
trial at that sittings the hearingofwhichhasnotcommencedbeforethedateappointedforthecommencement of
the next ensuing civil sittings at the place at which it wasentered for trial or to which it was
adjourned for trial shall, unless the CourtoraJudgeotherwiseorders,standadjournedtosuchnextensuingcivilsittings.
235Rules of the Supreme Court†6. Assessors, special referees, and
arbitrators˙Trial with assessors40.Trials with assessors shall take place
in such manner and upon suchterms as the
Court or a Judge may direct; and the assessors shall be
chosenand sworn in such manner, and their
remuneration shall be of such amount,and shall be paid
by such party in the first instance, as the Court or Judgemay
direct.˙Sittings of special referee—inspection
or view41.(1)When a cause or
matter, or any question in any cause or matter, isreferred to a special referee, the special
referee may, subject to the order ofthe Court or a
Judge, hold the inquiry at, or adjourn it to, any place
whichthespecialrefereemaydeemmostconvenient,andmayhaveanyinspection or view which the special referee
may deem expedient for thebetter disposal of the controversy
before him or her.(2)The special referee shall, unless
otherwise directed by the Court or aJudge, proceed
with the inquiry from day to day, in the same manner as inactions tried with a jury.˙Evidence at trial before special
referee42.Subject to any order made by the Court
or Judge in any particularcase, evidence shall be taken at
inquiries before special referees, and theattendance of
witnesses at such inquiries may be enforced, and the
inquiriesshall be conducted, in the same manner, as
nearly as circumstances willadmit, as trials
are conducted before a Judge.˙Authority of special referee43.(1)Subject to any
such order as last aforesaid, a special referee shallhave
the same authority in the conduct of the reference as a Judge has
whenpresiding at a trial.(2)Butthisruledoesnotauthoriseaspecialrefereetocommitanyperson to prison or to enforce any order by
attachment or otherwise.
236Rules of the Supreme Court˙Special referee may submit questions to
the Court—Court may remitcase or decide it44.The
special referee may, before the conclusion of any inquiry
beforehim or her, or by his or her report under the
reference made to the specialreferee, submit
any question arising therein for the decision of the Court,
ormay state any facts specially, with power to
the Court to draw inferencestherefrom, and in
any such case the order to be made on such submissionor
statement shall be entered as the Court may direct; and the Court
shallhave power to require any explanation or
reasons from the special referee,and to remit any
question for fresh inquiry or further consideration to thespecial referee or to another special
referee; or the Court may decide thequestion referred
to any special referee on the evidence taken before thespecial referee, either with or without
additional evidence as the Court maydirect.˙Notice of special referee’s
report45.When a report is made by a special
referee, the special referee shallon the same day
cause notice thereof to be given to all the parties to theinquirybeforethespecialrefereebyprepaidpostletterdirectedtotheaddress for
service of each party, and the parties shall be deemed to
havenotice of such report in due course of
post.˙Judgment on report of special
referee46.When any question arising in a cause
or matter has been referred to aspecial referee,
either party may set down a motion for the adoption of thereport and for judgment in accordance
therewith.˙Same where further consideration of
cause not adjourned47.When the report of a special referee
has been made in a cause ormatter the
further consideration of which has not been adjourned, any
partymay, upon 8 days notice, apply to the Court
by motion to adopt and carryinto effect the
report of the special referee, or to vary the report, or to
remitanyquestionforre-hearingorfurtherconsiderationtothesameortoanother special referee.
237Rules of the Supreme Court˙Adoption or variation of report of
special referee where furtherconsideration of
cause has been adjourned48.When the report
of a special referee has been made in a cause ormatter the further consideration of which has
been adjourned, any partymay, on such further consideration,
without notice of motion or summons,apply to the
Court or Judge to adopt the report, or may, without leave of
theCourt or a Judge, give not less than 4 days
notice of motion, to come onwith the further
consideration, to vary the report or to remit any question
forre-hearing or further consideration to the
same or to another special referee.˙Setting aside report49.(1)TheCourtmaysetasidethereportofaspecialrefereeontheground of error
in law or fact.(2)The application for the order shall be
made by motion, which may bebrought on with a
motion for the adoption of the report.(3)Upon
hearing the motion the Court may order that the whole matteror
some specific question be referred back for further report to the
same orto another special referee.˙Arbitrators etc. under an order to have
the powers of a referee50.The provisions
of rules 41 to 49 shall apply where any matter ofaccount is referred to an arbitrator, officer
of the Court, Judge of a DistrictCourt,associate,orcommissioner,oftheSupremeCourt,undertheInterdict Act 1867, section
10.†7. Writs of inquiry and references as
to damages˙Abolition of writ of inquiry51.No writ of inquiry shall be issued in
any cause or matter.˙Assessment of
damages by a Master, District Court Judge or registrar52.(1)Wherejudgmentisgivenfordamagestobeassessed,andno
238Rules of the Supreme Courtprovision is made by the judgment as to how
they are to be assessed, thedamagesshall,subjecttotheprovisionsofthisorder,beassessedbyaMaster, District Court Judge or a
registrar, at the option of the party entitledto the benefit of
the judgment, and the party entitled to the benefit of thejudgmentmay,afterobtainingthenecessarydateforhearingfromtheMasterorDistrictCourtJudgeorthenecessaryappointmentfromtheregistrar, as the case may be, and, at
least 10 days before the date of thehearing or
appointment serving notice thereof on the party against whomthe
judgment is given, proceed accordingly.(2)Where the party against whom a judgment is
given has not for thetime being an address for service, a
notice under this rule shall be deemed tobe properly
served on the party if left, or sent by post in a prepaid
letteraddressed to the party, at his or her normal
or last known residence, or,where the party
is a body corporate, its registered or principal office, and,
ifserved by post, to have been served at the
time at which it would have beendelivered in the
ordinary course of post.(3)Without
prejudice to any other power or discretion of the Master,District Court Judge or of the registrar, the
attendance of witnesses and theproductionofdocumentsbeforetheMaster,DistrictCourtJudgeortheregistrar may be
compelled by subpoena, and the Master, District CourtJudge
or the registrar may adjourn the matter from time to time.˙Certificate of amount of damages53.(1)WhereinpursuanceofthisorderdamagesareassessedbyaDistrict Court Judge or the registrar,
the District Court Judge or registrarshall certify the
amount of damages found by him or her and shall deliver acopy
of the certificate to the person entitled to the damages.(2)The certificate shall be filed in the
registry.˙Judgment in default against 1 of 2 or
more defendants53A.Where any such
judgment as is mentioned in rule 52 is given indefaultofappearanceorindefaultofdefence,andtheactionproceedsagainst other defendants, the damages under
the judgment shall be assessedat the trial
unless the Court or a Judge otherwise orders.
239Rules of the Supreme Court˙Court or Judge may order assessment
before Judge, officer of theCourt etc.53B.The Court or a
Judge may, in the case of any such judgment as ismentioned in rule 52, order that the
assessment of damages shall be referredto a Judge or to
any officer of the Court or to any Magistrates Court, orshall
be made in any other way which the Court or a Judge may direct,
andsave as is otherwise provided in such order
the provisions of rules 52 and53 shall mutatis
mutandis apply.˙Assessment of value53C.Rules 52 to 53B shall apply in relation to a
judgment for the valueof goods to be assessed, with or
without damages to be assessed, as theyapply to a
judgment for damages to be assessed, and references in thoserules
to the assessment of damages shall be construed accordingly.˙Damages in respect of continuing cause
of action54.When damages are to be assessed in
respect of a continuing cause ofaction, they
shall be assessed down to the time of the assessment.†ORDER 40†1.
Evidence˙Witnesses to be examined viva voce,
unless otherwise agreed orordered1.(1)In
the absence of any agreement between the parties testified
byconsent order, and subject to these rules,
the witnesses at the trial of anycause or at any
assessment of damages shall be examined viva voce and inopen
court, but the Court or a Judge may at any time for sufficient
reasonorder that any particular fact or facts may
be proved by affidavit, or that theaffidavitofanywitnessmaybereadatthehearingortrial,onsuchconditions as the
Court or Judge may think reasonable, or that any
witness
240Rules of the Supreme Courtwhose
attendance in court ought for some sufficient cause to be
dispensedwithshallbeexaminedbyinterrogatoriesorotherwisebeforeacommissioner or examiner.(2)However, when it appears to the Court
or Judge that any party bonafide desires the
production of a witness for cross-examination, and that suchwitnesscanbeproduced,anordershallnotbemadeauthorisingtheevidence of such witness to be given by
affidavit.˙Evidence by telephone, video link or
another form of communication1A.(1)The
Court, a Judge or a registrar may, in a proceeding,
determineto receive evidence or submissions by
telephone, video link or another formof
communication.(2)The Court, the Judge or the registrar
may impose conditions undersubrule
(1).˙Evidence etc. to be taken down in
shorthand2.(1)The evidence
given at the trial of an action, and any ruling, directionor
summing up thereat, shall be taken down in shorthand by a reporter
orreportersoftheStateReportingBureauunlesstheCourtoraJudgeotherwise
orders.(2)TheCourtoraJudgemaydirectthattheevidenceoranyotherproceedings
(including any argument, ruling, direction or judgment) in
anycause or matter shall be taken down in
shorthand by a reporter or reportersof the said
Bureau.˙Proof on trial in default of appearance
in admiralty actions in rem3.Uponthetrialofanadmiraltyactioninremupondefaultofappearance, the claim must be proved to the
satisfaction of the Judge.˙Affidavit evidence
in admiralty references4.Indefaultactionsinrem,andinreferencesinadmiraltyactionsevidence may be given by
affidavit.
241Rules of the Supreme Court˙Reading evidence taken in other causes
or matters5.Whenevidencetakeninanothercauseormatterisadmissible,anorder
to read it shall not be necessary, but such evidence may, saving
all justexceptions, be read, in the case of an ex
parte application by leave of theCourt or a Judge,
to be obtained at the time of making the application, and,inanyothercase,uponthepartydesiringtousesuchevidencegiving2
days previous notice to the other party of his or her intention to
read it.˙Office copies admissible in
evidence6.Office copies of writs, records,
pleadings, and documents filed in theCourt shall be
admissible in evidence in all causes and matters, and
betweenallpersonsorparties,tothesameextentastheoriginalwouldbeadmissible.˙Distribution of property—evidence7.(1)In any case
relating to the distribution of any property, whether incourt
or out of court, the Judge may, in order to avoid expense or
delay,admit as evidence statements on oath of
information and belief, and suchother evidence
as, having regard to the circumstances of the case, may bereasonable.(2)As
regards proceedings before the registrar, the Judge may
exercisehisorherdiscretionunderthisrule,withoutanyformalapplication,bygiving directions to the registrar in any
particular case as to the nature of theevidence to be
admitted.†2. Examination of witnesses˙Court or Judge may order evidence to be
taken8.TheCourtoraJudgemay,inanycauseormatter,ifitappearsnecessary for the
purposes of justice, make an order for the examination ofany
person upon oath before the Court or Judge, or before any officer
of theCourt, or other person, and at any place, or
may order a commission to beissued to any
person, either in Queensland or elsewhere, authorising theperson to take the evidence on oath of any
person, and may empower any
242Rules of the Supreme Courtparty
to any such cause or matter to give in evidence in the cause or
matterthe deposition so taken, on such terms (if
any) as the Court or Judge maydirect.˙Form of commission9.(1)Acommissiontoexaminewitnessesmustbeinschedule1,form
178.(2)The form may include variations that
the circumstances of the caserequire.˙Request to examine witnesses10.(1)TheCourtoraJudgemay,inanycaseinwhicharequesttoexamine witnesses may by law be issued, order
that a request to examinewitnesses be issued in lieu of a
commission.(2)The forms in schedule 1 shall be used
for such order and requestrespectively, with such variations as
circumstances may require.˙Order for
attendance of person to produce documents11.(1)The
Court or a Judge may, in any cause or matter, at any stage
ofthe proceedings order the attendance of any
person before the Court or aJudge for the
purpose of producing any writing or other document namedin
the order which the Court or Judge may think fit to be
produced.(2)However, no person shall be compelled
to produce under any suchorderanywritingorotherdocumentwhichthepersoncouldnotbecompelled to
produce at the hearing or trial.˙Disobedience to order for attendance12.Anypersonwhowilfullydisobeysanyorderrequiringhisorherattendance for the purpose of being examined
or producing any documentshallbedeemedguiltyofcontemptofcourt,andmaybedealtwithaccordingly.
243Rules of the Supreme Court˙Expenses of person ordered to
attend13.Any person required to attend for the
purpose of being examined orof producing any
document shall be entitled to the like conduct money andpayment for expenses and loss of time as upon
attendance at a trial in court.˙Examiner to have copy writ and
pleadings14.When any witness or person is ordered
to be examined before anyofficeroftheCourt,oranyotherpersonappointedforthepurpose,theperson taking the examination shall be
furnished by the party on whoseapplication the
order was made with a copy of the writ and pleadings (ifany)
or with a copy of the documents necessary to inform the person
takingthe examination of the questions at issue
between the parties.˙Persons to be
present at examination15.The examination
shall take place in the presence of the parties, theircounsel,solicitors,oragents,andthewitnessesshallbesubjecttocross-examination and re-examination.˙Depositions to be taken down in
writing, read over to and signed bywitness, or, if
the witness refuses, by the examiner—questionsobjected to16.(1)The depositions
taken before an officer of the Court, or any otherperson appointed to take the examination,
shall be taken down in writing byor in the
presence of the examiner, ordinarily by question and answer, so
asto represent as nearly as may be the
statement of the witness, and whencompleted shall
be read over to the witness and signed by the witness in thepresence of the parties, or such of them as
may think fit to attend.(2)If the witness
refuses to sign the depositions, the examiner shall signthe
same.(3)The examiner may put any question to
the witness as to the meaningof any answer, or
as to any matter arising in the course of the examination.(4)Any questions which may be objected to
shall be taken down by theexaminer in the depositions, with a
note of the objection, but the examiner
244Rules of the Supreme Courtshall
not have power to decide upon the materiality or relevancy of
anyquestion.˙Refusal of witness to attend or to be
sworn17.If any person duly summoned by
subpoena to attend for examinationrefuses to
attend, or if, having attended, the person refuses to be sworn or
toansweranylawfulquestion,acertificateofsuchrefusal,signedbytheexaminer, shall be filed in the
registry, and thereupon the party requiring theattendance of the
witness may apply to the Court or a Judge, ex parte or onnotice, for an order directing the witness to
attend, or to be sworn, or toanswer any
question, as the case may be.˙Objection by witness to questions18.Ifanywitnessobjectstoanyquestionwhichmaybeputtothewitness before an examiner, the
question so put, and the objection of thewitness thereto,
shall be taken down by the examiner and transmitted by theexaminer to the registry, to be there filed,
and the validity of the objectionshall be decided
by the Court or a Judge.˙Costs occasioned
by refusal or objection19.In any case
under rules 17 and 18, the Court or a Judge may orderthe
witness to pay any costs occasioned by the wintess’ refusal or
objection.˙Depositions to be transmitted to
registry20.(1)Whentheexaminationofanywitnessbeforeanexaminerhasbeen
concluded, the original depositions, authenticated by the signature
ofthe examiner, shall be transmitted by the
examiner to the registry, and therefiled.(2)Any party may have a copy of the
depositions, or of any part thereof,on payment of the
prescribed fee.
245Rules of the Supreme Court˙Special report by examiner21.The person taking the examination of a
witness under these rulesmay, and if need be shall, make a
special report to the Court touching suchexaminationandtheconductorabsenceofanywitnessorotherpersonthereon, and the Court or a Judge may
thereupon direct such proceedings tobe taken, and may
make such order, as upon the report may be just.˙Depositions not to be given in evidence
without consent or by leave ofJudge22.Except as by this order otherwise
provided, no deposition shall begiven in evidence
at the hearing or trial of a cause or matter without theconsent of the party against whom the same is
offered, unless the Court orJudge is
satisfied that the deponent is dead, or beyond the jurisdiction of
theCourt, or unable from sickness or other
infirmity to attend the hearing ortrial, in any of
which cases the depositions certified under the hand of theperson taking the examination shall be
admissible in evidence, saving alljust exceptions,
without proof of the signature to such certificate.˙Oaths23.AnyofficeroftheCourtorotherpersondirectedtotaketheexaminationofanypersonmayadministerthenecessaryoathstosuchperson.˙Evidence taken after trial24.Evidencetakensubsequentlytothehearingortrialofacauseormatter shall be taken as nearly as may be in
the same manner as evidencetaken at or with
a view to a trial.˙Practice as to taking evidence at any
stage of a cause or matter25.The practice
with reference to the examination, cross-examination,and
re-examination of witnesses at a trial shall extend and be
applicable toevidence taken in any cause or matter at any
stage.
246Rules of the Supreme Court˙Special directions as to taking
evidence26.The practice of the Court with respect
to evidence at a trial, whenapplied to
evidence to be taken before an officer of the Court or other
personinanycauseormatterafterthehearingortrial,shallbesubjecttoanyspecial directions which may be given
in any case.˙Notice to use affidavit or depositions
at trial27.An affidavit or deposition filed or
made before issue joined in anycause or matter
shall not, without special leave of the Court or a Judge, bereceived at the hearing or trial thereof as
evidence for the party on whosebehalf it is
filed, unless, not later than 1 month after issue joined, or
withinsuch further period as may be allowed by
special leave of the Court or aJudge, notice in
writing has been given by the party intending to use thesame
to the opposite party of his or her intention to do so.˙Evidence in proceedings subsequent to
trial28.Evidence taken at the hearing or trial
of a cause or matter may beused in any
subsequent proceedings in the same cause or matter.†3. Subpoenas˙Attendance of witness under subpoena for
examination or to producedocuments29.Any
party to a cause or matter may, subject to these rules, by a
writofsubpoenaadtestificandumorsubpoenaducestecum,requiretheattendance of any person, or the production
of any document, before theCourt or Judge at
the hearing or trial, or on the hearing of any motion orapplication in the cause or matter, or before
the registrar or other officer ofthe Court or
other person appointed to make any inquiry in the cause ormatter,orbeforeanypersonappointedtotakeanyexaminationofwitnesses.
247Rules of the Supreme Court˙Form of writ of subpoena30.A writ of subpoena shall be in the
appropriate form in schedule 1,with such
variations as circumstances may require.˙Subpoena for attendance of witness in
chambers31.When a subpoena is required for the
attendance of a witness for thepurpose of
proceedings in chambers, such subpoena shall issue from theregistry upon a fiat of the Judge.˙Subpoena for attendance before
registrar32.When a subpoena is required for the
attendance of a witness for thepurpose of
proceedings before the registrar or other officer of the
Court,such subpoena shall be issued upon the
direction of the registrar or suchofficer.˙Number of persons in a subpoena other
than a subpoena duces tecum33.Every subpoena
other than asubpoena duces tecumshall contain
thenames of 3 persons when necessary or
required, but may contain the namesof any larger
number of persons.˙Correction of errors in subpoena35.In the interval between the suing out
and the service of any subpoenathe party suing
out the same may correct any error in the names of partiesorwitnesses,andmayhavethewritre-sealeduponleavingacorrectedpraecipe for such
subpoena marked with the words ‘altered and re-sealed’,and
signed with the name and address of the solicitor or party suing
out thesame.˙Service of subpoena36.(1)The
service of a subpoena shall be effected in the same manner
asthe service of a writ of summons in an
action.
248Rules of the Supreme Court(2)The copy of a subpoena for a witness
served upon the witness neednot contain the
name of any witness other than the person served.˙Affidavit to prove service of
subpoena37.Affidavits filed for the purpose of
proving the service of a subpoenaupon any person
must state when, where, and how, and by whom, suchservice was effected.˙Within
what time subpoena to be served38.The
service of a subpoena shall be of no validity unless it is
madewithin 12 weeks after the date of issue of
the writ.†3A. Non-party discovery˙Writ of non-party discovery38A.A party to a
cause may, by writ of non-party discovery, require aperson who is not a party to the cause, to
produce to the party a documentthat—(a)relates to the matter in question in
the cause; and(b)is in the person’s possession or
control; and(c)the person could be required to
produce at the trial of the matter.˙Form
and service of writ38B.The writ
must—(a)be in schedule 1, form 169A;
and(b)be served within 7 days after its
issue in the same way as a writof
summons.˙Application to set aside or vary
writ38C.The respondent
to the writ may, within 14 days after its service,
249Rules of the Supreme Courtapply
to a Judge to have it set aside or varied, and the Judge may make
suchorder as the Judge determines.˙Privilege or objection to
discovery38D.If, in relation
to the production of a document, the respondent—(a)makes a claim of privilege; or(b)otherwise objects to its production;
or(c)fails to produce it;the
applicant for the writ, or the respondent, may apply to a Judge for
adetermination in relation to the claim or
objection or failure to produce thedocument, and the
Judge may make such order as the Judge determines.˙Production and copying of
documents38E.(1)Subject to any
order under rules 38C and 38D, the respondentmust, within 14
days after the service of the writ, produce the documentspecified in the writ for inspection by the
applicant at the place of businessoftherespondentortherespondent’ssolicitorwithinordinarybusinesshours,unlesstheapplicantandtherespondentagreetothedocument’sproduction at
some other place or time.(2)The applicant
may copy the produced document.˙Costs38F.The respondent’s
costs and expenses of producing the documentmust be paid by
the applicant after being taxed, unless the applicant and
therespondent agree otherwise.†4. Perpetuating testimony˙Action to perpetuate testimony39.Anypersonwhowould,underthecircumstancesallegedbytheperson to exist,
become entitled, upon the happening of any future event,
to
250Rules of the Supreme Courtanyhonour,title,dignity,oroffice,ortoanyestateorinterestinanyproperty, real or personal, the right
or claim to which cannot by the personbe brought to
trial before the happening of such event, may commence anaction to perpetuate any testimony which may
be material for establishingsuch right or
claim.˙When Attorney-General should be made a
defendant to an action toperpetuate testimony40.In actions to perpetuate testimony
touching any honour, title, dignity,or office, or any
matter or thing in which the Crown may have any estate orinterest, the Attorney-General may be made a
defendant as representing theCrown;andthedepositionstakeninanysuchactioninwhichtheAttorney-Generalissomadeadefendantshallbeadmissibleinanyproceedings in which they are otherwise
admissible, notwithstanding anyobjection that
might be taken to them upon the ground that the Crown wasnot a
party to the action in which such depositions were taken.˙Examination of witnesses to perpetuate
testimony41.Witnesses shall not be examined to
perpetuate testimony unless anaction has been
commenced for that purpose.˙Action
not to be set down for trial42.An
action to perpetuate the testimony of witnesses shall not be
setdownfortrial,butevidenceshallbetakenthereininsuchmanner,andbefore such person, as the Court or a
Judge may direct.†5. Obtaining evidence for foreign
tribunals˙Evidence for foreign tribunals43.WhereundertheForeignTribunalsEvidenceAct1856,ortheExtradition Act
1870, section 24, any civil or commercial matter
or anycriminal matter is pending before a court or
tribunal of a foreign countryand it is made to
appear to the Court or a Judge, by commission rogatoireor
letter of request, or other evidence as hereinafter provided, that
such court
251Rules of the Supreme Courtor
tribunal is desirous of obtaining the testimony in relation to such
matterof any witness or witnesses within the
jurisdiction the Court or a Judgemay, on the ex
parte application of any person shown to be duly authorisedto
make the application on behalf of such foreign court or tribunal,
and onproductionofthecommissionrogatoireorletterofrequest,orofacertificate
signed in the manner, and certifying to the effect mentioned in
theForeign Tribunals Evidence Act 1856,
section 2, or such other evidence asthe Court or a
Judge may require, make such order or orders as may benecessary to give effect to the intention of
the Acts above mentioned inconformity with
theForeign Tribunals Evidence Act 1856,
section 1.˙Form of order44.An
order made under rule 43 shall be in form in schedule 1,
withsuch variations as circumstances may
require.˙Before what persons examination
conducted45.Theexaminationmaybeorderedtobetakenbeforeanyfitandproper person nominated by the person
applying, or before any officer ofthe Court, or
such other qualified person as to the Court or a Judge mayseem
fit.˙How depositions to be forwarded46.Unless otherwise provided in the order
for examination, the personbefore whom the
examination is taken shall, on its completion, forward thesame
to the registrar of the Supreme Court, and on receipt thereof
suchofficer shall append thereto a certificate,
in form in schedule 1, with suchvariations as
circumstances may require, duly sealed with the seal of theSupremeCourt,andshallforwardthedepositionssocertified,andthecommission rogatoire or letter of
request (if any) to the Attorney-General oftheStatefortransmissiontoHerMajesty’sSecretaryofStatefortheColonies.˙Transmission of depositions direct to foreign
tribunals47.The Court or a Judge may in any case
and at any time order that the
252Rules of the Supreme Courtcertified depositions and the commission
rogatoire or letter of request (ifany)shallbeforwardedtotheAttorney-GeneraloftheStatefortransmission direct to the foreign court or
tribunal desirous of obtaining thesaid
testimony.˙Manner of examination48.(1)An order made
under rule 43 may, if the Court or a Judge shallthink
fit, direct the said examination to be taken in such manner as may
berequested by the commission rogatoire or
letter of request from the foreigncourt,orthereinsignifiedtobeinaccordancewiththepracticeorrequirements of such court or tribunal, or
which may, for the same reason,be requested by
the applicant for such order.(2)But
in the absence of any such special directions the
examinationshall be taken in the manner prescribed by
the rules and practice of theCourt.˙Application by Crown Solicitor49.Where a commission rogatoire or letter
of request, as mentioned inrule 43, is
transmitted to the Supreme Court by His or Her Excellency
theGovernor with an intimation that it is
desirable that effect should be given tothe same without
requiring an application to be made to the Court by theagents in Queensland of any of the parties to
the action or matter in theforeign country,
the registrar shall transmit the same to the Crown
Solicitor,who may thereupon, with the consent of the
Attorney-General, make suchapplications and
take such steps as may be necessary to give effect to suchcommission rogatoire or letter of request, in
accordance with these rules.†6.
Obtaining evidence under conventions respecting legal
proceedingsin civil and commercial matters˙Request from consul etc. of country
party to convention50.Anycommissionsrogatoiresorlettersofrequestreceivedbytheregistrar from
any consul or consular or diplomatic agent in Brisbane of
anycountrybetweenwhichcountryandtheUnitedKingdomorthe
253Rules of the Supreme CourtCommonwealth of Australia there is existing a
convention regarding legalproceedings in civil and commercial
matters, shall be dealt with in the samemanner as
provided by rules 43 to 48 in respect to any civil or
commercialmatter mentioned therein with all necessary
variations, including the returnof the
commissions rogatoires or letters of request and depositions to
thesaidconsulorconsularordiplomaticagentinsteadoftotheAttorney-General
for the State.˙Application of forms51.The forms mentioned in rules 44 and 46
shall, with the necessaryalterations, apply to rule 50.˙Language52.The
commission rogatoire or letters of request shall be drawn up
inthe language of the country of origin,
accompanied by a translation in theEnglish
language.˙Consul etc. to be informed of date and
place of proceedings53.The said consul or consular or
diplomatic agent shall, if he or she sodesires, be
informed of the date and place where the proceedings asked
forwill take place.˙No
fees payable54.No fees of court shall be payable in
respect to the execution of thecommission
rogatoire or letters of request.˙Power
of examiner55.The person appointed to take the
examination of witnesses shall havethe same power
and authority as a person appointed to take an examinationof
witnesses in a matter pending in the Supreme Court.
254Rules of the Supreme Court†7. Dispensing with rules of
evidence˙Court may dispense with rules of
evidence56.(1)The court may,
at any time during a proceeding, dispense with therules
of evidence relating to the proof of a fact if the court considers
thatstrict proof of the fact might cause
unnecessary or unreasonable expense,delay or
inconvenience in the proceeding or that the fact is not seriously
indispute.(2)Without limiting subrule (1), the court may
dispense with the rulesabout proof of handwriting, documents,
authority or identity.(3)This rule
applies regardless of the importance of the fact sought to
beproved.†ORDER 41—AFFIDAVITS˙Evidence on motions etc.1.Upon
any motion, petition, or summons, evidence may be given byaffidavit; but the Court or a Judge may, on
the application of either party,order that a
subpoena shall be issued requiring any person making any
suchaffidavit to attend before the Court or
Judge, or an officer of the Court, orcommissioner of
affidavits, for cross-examination.˙Title
of affidavits2.(1)Every affidavit
shall be entitled in the cause or matter in which it issworn,ifanyisthenpending;butinanycaseinwhichtherearemoreplaintiffs or
defendants than 1, it shall be sufficient to give the full name
ofthe first plaintiff or defendant
respectively, adding the words ‘and another’,or‘andothers’,asthecasemaybe;andthecostsoccasionedbyanyunnecessary prolixity in any such title
shall be disallowed by the taxingofficer.(2)If no cause or matter is pending, it
shall not be necessary to entitle theaffidavit
otherwise than as provided by order 2, rule 7.
255Rules of the Supreme Court˙Contents of affidavits3.(1)Affidavits shall
be confined to facts to which the deponent is able todepose of his or her own knowledge, except in
the cases specially providedfor by these
rules, and except in the case of affidavits used on
interlocutorymotionsorapplications,inwhichstatementsastothebeliefofthedeponent, giving
the sources of the deponent’s information and the groundsof
his or her belief, may be admitted.(2)The
costs of any affidavit which unnecessarily sets forth matters
ofhearsay, or argumentative matter, or copies
of or extracts from documents,may be disallowed
on taxation.˙Form of affidavits4.(1)Every affidavit shall be drawn up in the
first person, and shall bedividedintoparagraphs,andeveryparagraphshallbenumberedconsecutively,andshall,asnearlyasmaybe,beconfinedtoadistinctportion of the
subject.(2)No costs shall be allowed for any
affidavit or part of an affidavitwhich
substantially violates this rule.˙Description of abode or true place of
business or employment ofdeponent to be stated5.Every affidavit shall state the
description and the true place of abode ortrue place of
business or place of employment of the deponent.˙Jurat several sheets6.(1)Thejuratofanaffidavitmuststatethatitwasswornbythedeponent on the
day and at the place where it was sworn.(2)Eachseparatesheetmustbesignedbythedeponentandbytheperson before
whom the affidavit is taken.˙Affidavits made by 2 or more deponents7.In an affidavit made by 2 or more
deponents the names of the severalpersons making
the affidavit must be inserted at length in the jurat,
except
256Rules of the Supreme Courtthat
if the affidavit is sworn by all the deponents at the same time by
thesame officer it shall be sufficient to state
that it was sworn by ‘both’ or ‘all’the ‘abovenamed’
deponents, using those words.˙Alterations in affidavits8.An
affidavit which has either in the body thereof or in the jurat
anyinterlineation, alteration, or erasure, shall
not, without leave of the Court or aJudge,bereadormadeuseofinanycauseormatterunlesstheinterlineationoralteration,notbeingbyerasure,isauthenticatedbytheinitials of the officer taking the
affidavit, or, if the affidavit is taken in theregistry, either
by his or her initials or by the office stamp; nor, in the
caseof an erasure, unless the words or figures
appearing at the time of taking theaffidavit to be
written on the erasure are re-written and signed or initialled
inthe margin of the affidavit by the officer
taking it.˙Affidavits by illiterate or blind
persons9.(1)Whenanaffidavitisswornbyanypersonwhoappearstotheofficer before whom it is taken to be
illiterate or blind, the officer shallcertify in the
jurat that the affidavit was read in the officer’s presence to
thedeponent, that the deponent seemed perfectly
to understand it, and that thedeponent made his
or her signature or mark in the presence of the officer.(2)No such affidavit shall be used in
evidence in the absence of thiscertificate,unlesstheCourtoraJudgeisotherwisesatisfiedthattheaffidavit was read over to and appeared to be
perfectly understood by thedeponent.˙Affirmation10.When
a deponent does not take an oath, the form of jurat shall bevaried,andthenecessaryalterationsmade,soastoconformwiththesolemn affirmation or other declaration
of the deponent.˙Affidavits to be filed11.(1)Every affidavit
shall be filed in the registry.
257Rules of the Supreme Court(2)A note shall be endorsed on every
affidavit stating the name of thedeponent and on
whose behalf it is filed, and no affidavit shall, without
theleave of the Court or a Judge, be filed or
used without such note endorsedthereon.˙Scandalous matter12.The
Court or a Judge may order any matter which is scandalous to
bestruck out from any affidavit, and may order
the costs of any application tostrike out such
matter to be paid as between solicitor and client.˙Use of defective affidavit13.Notwithstanding anything in rules 1 to
12, the Court or a Judge mayreceive any
affidavit sworn for the purpose of being used in any cause
ormatter,notwithstandinganydefect,bymisdescriptionofpartiesorotherwise, in the title or jurat, or any
other irregularity, and may direct amemorandum to be
made on the affidavit that it has been so received.˙Alterations in accounts to be
initialled14.Everyalterationinanaccountverifiedbyaffidavittobeleftatchambers or in the registry shall be marked
with the initials of the officerbefore whom the
affidavit is taken, and such alteration shall not be made byerasure.˙Exhibits15.(1)Documents and other objects and things
referred to by affidavitshallnotbeannexedtotheaffidavitorreferredtointheaffidavitasannexed, but shall be referred to as
exhibits.(2)Instead of making a document an
exhibit to an affidavit the relevantportion of the
document may be included in the body of the affidavit and
theparty filing the affidavit shall in that case
produce the document wheneverthe affidavit is
used.
258Rules of the Supreme Court˙Certificate on exhibit16.An exhibit to an affidavit shall have
endorsed on it the short title ofthe proceeding
(if any) and the number (if any) of the proceeding, and acertificate in the form in schedule 1 signed
by the person before whom theaffidavit is
sworn or taken identifying the exhibit with the affidavit to
whichit is an exhibit.˙Use of
figures16A.In an affidavit
dates and sums of money may be written or printedin
figures instead of words.˙Originals to be
used17.Original affidavits may be used in all
cases.˙Stamping of affidavits, and use of
office copies18.(1)Beforeanoriginalaffidavitisallowedtobeused,itshallbestamped with a filing stamp to be kept for
that purpose, and, if not alreadyfiled, shall at
the time when it is used be delivered to and left with the
properofficer in court or in chambers, who shall
send it to be filed.(2)An office copy of an affidavit may be
used instead of the original, theoriginalaffidavithavingbeenpreviouslyfiled,andthecopybeingdulyauthenticated with the seal of the
office.˙Affidavit sworn before the party19.An affidavit sworn before the party
himself or herself shall not bereceived.˙Special times for filing
affidavits20.When a special time is limited for
filing affidavits, an affidavit filedafter that time
shall not be used without leave of the Court or a
Judge.
259Rules of the Supreme Court˙Affidavits in support of ex parte
applications21.Except by leave of the Court or a
Judge, an order made ex parte incourt founded on
any affidavit shall not be drawn up unless the affidavit onwhich
the application was founded was actually made before the order
wasapplied for, and was produced or filed at the
time of making the motion.†2. Affidavits and
evidence in chambers in administrative jurisdiction˙Notice of intention to use affidavits
in chambers in certain cases22.A
party intending to use, in support of an application made by
thepartyinchambersinanycauseormatterpendingintheadministrativejurisdiction of
the Court, any affidavit which has not been previously read
incourtinthesamecauseormatter,shallgivenoticetotheotherpartiesconcerned of the
party’s intention to do so.˙Use in
chambers of affidavits used in Court23.AnyaffidavitwhichhasbeenpreviouslyreadinCourtuponanyproceeding in a cause or matter may be
used before the Judge in chambersor the registrar
without notice.†3. Trial on affidavit˙Time for filing plaintiff’s
affidavits24.Within 14 days after a consent order
for taking evidence by affidavitas between the
parties has been filed, or within such other time as the
partiesmay agree upon, or the Court or a Judge may
allow, the party having theconduct of the
proceedings shall file the party’s affidavits and deliver to
theopposite party a list thereof.˙Time for filing defendant’s
affidavits25.The opposite party shall, within 14
days after delivery of such list, orwithin such other
time as the parties may agree upon, or the Court or a
260Rules of the Supreme CourtJudge
may allow, file his or her affidavits and deliver to the other
party a listthereof.˙Affidavits in reply26.Within 7 days after the expiration of the
lastmentioned 14 days, orsuch other time as aforesaid, the party
who first filed his or her affidavitsshall file his or
her affidavits in reply, which affidavits shall be confined
tomatters strictly in reply, and shall deliver
a list thereof to the opposite party,and thereupon the
evidence shall be deemed to be closed.˙Cross-examination of deponent27.(1)Any party
desiring to cross-examine a deponent who has made anaffidavit filed on behalf of the opposite
party may serve upon the party bywhomsuchaffidavithasbeenfiledanoticeinwriting,requiringtheproduction of the deponent for
cross-examination at the trial.(2)Such
notice may be served at any time before the expiration of 7
daysnext after the expiration of the time allowed
for filing affidavits in reply, orwithin such
further period as the Court or a Judge may allow.(3)If any such deponent is not produced
accordingly, his or her affidavitshall not be used
as evidence, unless by the special leave of the Court or aJudge.(4)The
party producing such deponent for cross-examination shall
notbeentitledtodemandtheexpensesofhisorherattendanceinthefirstinstance from the
party requiring such production.˙Compelling attendance for
cross-examination28.A party to whom such notice as is
mentioned in rule 27 is given shallbe entitled to
compel the attendance of the deponent for cross-examinationin
the same way as the party might compel the attendance of a witness
to beexamined.˙Notice
of trial29.(1)When the
evidence is taken by affidavit under this order, notice
of
261Rules of the Supreme Courttrialshallbegivenasinothercases,andmaybegivenwithinthelikeperiods, but
calculated with reference to the close of the evidence instead
ofwith reference to the close of the
pleadings.(2)The notice must be for trial by a
Judge without a jury at Brisbane,Rockhampton,
Townsville or Cairns, or, by leave of the Court or a Judge,
ata circuit court.†4.
Commissioners for affidavits˙Time
and place of taking affidavits etc. to be stated30.Every commissioner or other person who
takes an affidavit, or anacknowledgment or recognisance, shall
express therein the time when andtheplacewherethecommissionerorotherpersontakestheaffidavit,acknowledgment,orrecognisance;otherwisethesameshallnotbeheldauthentic, nor be admitted to be filed
without the leave of the Court or aJudge; and every
such commissioner shall express in like manner the timewhen,
and the place where, the commissioner does any other act incident
tohis or her office.˙Publication of names register31.The issue of every commission for
taking affidavits shall be notifiedintheGazette,andaregisterofsuchcommissionsshallbekeptintheregistry, and published annually in the
Gazette.†ORDER 42—MOTION FOR JUDGMENT˙Motion for judgment1.Except when by statute or by these rules it
is provided that judgmentmay be obtained in any other manner,
the judgment of the Court shall beobtained upon
motion for judgment.
262Rules of the Supreme Court˙When no judgment given at trial2.(1)When at the
trial of a cause the Judge does not direct any judgmentto be
entered, the plaintiff may set down the cause on motion for
judgment.(2)If the plaintiff does not set down the
cause and give notice of suchsetting down to
the other parties within 10 days after the trial, any
defendantmay set down the cause on motion for judgment
and give notice of suchsetting down to the other
parties.˙Setting down motion for judgment when
issues have been directedand tried3.(1)When
issues have been ordered to be tried, or questions or issuesof
fact have been ordered to be determined in any manner, the
plaintiff mayset down a motion for judgment as soon as
such questions or issues havebeen
determined.(2)If the plaintiff does not set down
such a motion, and give notice ofsuch setting down
to the other parties within 10 days after his or her right
soto do has arisen, then after the expiration
of such 10 days any defendantmay set down a
motion for judgment, and give notice of such setting downto
the other parties.˙When some only of several issues
directed have been tried4.(1)When issues have
been ordered to be tried, or questions or issuesof
fact have been ordered to be determined in any manner, and some
onlyof such questions or issues of fact have been
tried or determined, any partywho considers
that the result of such trial or determination renders the
trialor determination of the others of them
unnecessary, or renders it desirablethat the trial or
determination of the others should be postponed, may, byleave
of the Court or a Judge, set down a motion for judgment,
withoutwaiting for such trial or
determination.(2)And the Court or Judge may, if
satisfied of the expediency thereof,give such leave,
upon such terms (if any) as may be just, and may give anydirections which may be desirable as to
postponing the trial of the otherquestions or
issues of fact.
263Rules of the Supreme Court˙Motion to be set down within 1
year5.A motion for judgment shall not,
except by leave of the Court or aJudge, be set
down after the expiration of 1 year from the time when theparty
seeking to set down the same first became entitled to do so.˙Power of Court on motion for
judgment6.Upon a motion for judgment, the Court
may draw any inference offactnotinconsistentwiththefindingsofthejury(ifany)andmay,ifsatisfiedthatithasbeforeitallthematerialsnecessaryforfinallydetermining the
questions in dispute, or any of them, or for awarding anyrelief sought, give judgment accordingly, or
may, if not so satisfied, directthemotiontostandoverforfurtherconsideration,andmaydirectsuchquestions or issues of fact to be tried or
determined, and such accounts andinquiries to be
taken and made, as may be just.˙Motion
for judgment on default or on admissions7.(1)Whenjudgmentisdesiredupondefaultofpleading,oruponadmissions,thecauseshallbesetdownonmotionforjudgment,andacopy of the pleadings or admissions
shall be filed.(2)This rule does not apply to the cases
mentioned in order 31, rules 2to 9.†ORDER 44—ENTRY OF JUDGMENTS˙Mode of entry1.(1)Every judgment shall be entered by the
proper officer in a book tobe kept for that
purpose.(2)The party entering the judgment shall
deliver to the officer a copy ofthe whole of the
pleadings (if any) not already filed.(3)Theformsinschedule1shallbeused,withsuchvariationsascircumstances may require.
264Rules of the Supreme Court˙Date of judgment pronounced in
court2.(1)WhenajudgmentispronouncedbytheCourtorbyaJudgeincourt, the entry of the judgment shall
be dated as of the day on which suchjudgment is
pronounced, unless the Court or Judge otherwise orders, andthe
judgment shall take effect from that date.(2)However, by special leave of the Court or a
Judge a judgment may beante-dated or post-dated.˙Date of entry of other judgments3.In any other case the entry of
judgment shall be dated as of the day onwhichtherequisitedocumentsareleftwiththeproperofficerforthepurpose of such
entry, and the judgement shall take effect from that date.˙Time to be stated for doing any act
ordered to bedone—memorandum to be endorsed4.Every judgment or order made in any
cause or matter requiring anyperson to do an
act thereby ordered to be done shall state the time, or thetime
after service of the judgment or order, within which the act is to
bedone, and there shall be endorsed upon the
copy of the judgment or orderserved upon the
person required to obey the same a memorandum in thewords
or to the effect following, viz.—‘If you, the
within-named A.B., neglect to obey this judgment [ororder]by the time
therein limited, you will be liable to process of execution for
thepurpose of compelling you to obey the
judgment [ororder]’.˙Judgment on production of affidavit or
document5.When by any statute or these rules, or
otherwise, it is provided thatany judgment may
be entered upon the filing of any affidavit or productionofanydocument,theofficershallexaminetheaffidavitordocumentproduced; and, if
the same is regular and contains all that is by law
required,the officer shall enter judgment
accordingly.
265Rules of the Supreme Court˙Judgment on production of order or
certificate6.When by any statute or these rules, or
otherwise, it is provided thatany judgment may
be entered pursuant to any order or certificate, or to thereturn to any writ, the production of such
order or certificate sealed with theseal of the
Court, or of such return, shall be a sufficient authority to
theofficer to enter judgment accordingly.˙Judgment on registrar’s
certificate7.When reference is made to the
registrar to ascertain the amount forwhich final
judgment is to be entered, the registrar’s certificate shall be
filedin the registry before judgment is
entered.˙Judgment by consent when party appears
by a solicitor8.In any cause in which a party has sued
or appeared by solicitor, aconsent order for
entering judgment against such party shall not be madeunless the consent of the party is given by
the party’s solicitor or the townagent of the
party’s solicitor.˙Consent of party in person9.When the plaintiff sues in person, or
the defendant has not appeared,or has appeared
in person, a consent order for entering judgment againstsuch
party shall not be made unless the party attends before a Judge
andpersonally gives consent, or unless the
party’s written consent is attested bya solicitor
acting on the party’s behalf, unless the party is himself or
herselfa barrister, solicitor, or
conveyancer.˙Judgment on warrant of attorney10.(1)Aftertheexpirationofayearfromthedateofawarrantofattorney, judgment shall not be entered up
thereon without the leave of ajudge.(2)Up to the expiration of 10 years from
the date thereof, such leavemaybeobtainedexparte,butatanylatertimemustbeappliedforbysummons to show cause.
266Rules of the Supreme Court˙Entry of satisfaction11.(1)Amemorandumofsatisfactionofajudgmentmaybeenteredupon a consent to
the entry, signed by the party entitled to the benefit of
thejudgment, and attested and verified by the
affidavit of the attesting witness,being filed in
the registry.(2)If the attesting witness is not a
solicitor, the approval of a Judge mustbe obtained,
which may be endorsed on the affidavit.†ORDER 45—RELIEF AGAINST JUDGMENTS ANDORDERS˙Matters arising after judgment or
order1.When facts arise after the giving of a
judgment or making of an orderwhich entitle the
person against whom the judgment or order is given ormade
to be relieved from it, or when facts are discovered after the
giving ofa judgment or making of an order which, if
discovered in time, would haveentitled the
party against whom the judgment or order is given or made to
ajudgment or decision in the party’s favour,
or to a different judgment ororder, the party
may apply to the Court or a Judge for a stay of execution orother
appropriate relief; and the Court or a Judge may grant such relief,
andforthatpurposemaydirectsuchproceedingstobetaken,andsuchquestions or
issue of fact to be tried or determined, and such inquiries to
bemade, as may be just.˙Entry
of satisfaction2.Any party against whom a judgment is
given may apply to the Courtor a Judge for an
order directing entry of satisfaction of the judgment to bemade,
and the Court may make such order accordingly.˙Procedure under this order exclusive3.No proceedings shall be taken for the
purpose of obtaining relief from
267Rules of the Supreme Courtjudgments or orders on the ground of facts
arising or discovered after thejudgment or
order, except as by this order provided.†ORDER 46—MONEYS IN COURT˙Payment or deposit of money in court1.(1)Where a person
is required or permitted by an Act, these rules, anorder
of the Court or any other law or practice to pay into or deposit
moneyincourtthatpersonshallfileanaffidavitthatcomplieswiththeCourtFunds Regulation
1988, section 6(1).(2)Anaffidavitfiledinaccordancewithsubrule(1)shallassoonaspracticableafteritisfiledbeservedonallotherpartiesandanyotherinterested person.˙Defamation2.(1)This
rule applies where a party makes a payment into court undertheDefamation Law Act 1889,
section 22.(2)On making a payment into court and on
increasing an amount alreadypaid into court
the defendant shall give notice in the form in schedule 1 tothe
plaintiff and every defendant.(3)The
defendant may increase the amount paid into court.(4)The defendant shall not withdraw money
paid into court or amend thenoticeofpaymentintocourtwithoutleaveoftheCourt,whichmaybegranted on
terms.(5)Where 2 or more causes of action for
defamation are joined in anactionandmoneyispaidintocourtthenunlesstheCourtoraJudgeotherwise orders
the notice of payment shall specify—(a)the
cause or causes of action in respect of which the payment ismade; and,(b)the
sum paid in respect of each cause of action.(6)Within 14 days after the date of receipt of
the notice of payment into
268Rules of the Supreme Courtcourt
or, where more than 1 payment has been made or the notice has
beenamended, within 14 days after the date of
receipt of the last notice or theamended notice
but, in any case, before the trial or hearing of the actionbegins, the plaintiff may—(a)where the money was paid in respect of
the cause of action or allofthecausesofactioninrespectofwhichtheplaintiffclaims—accept
the money in satisfaction of that cause of action orthose causes of action, as the case may be;
or(b)where the money was paid in respect of
some only of the causesofactioninrespectofwhichtheplaintiffclaims—acceptinsatisfactionofanysuchcauseorcausesofactionthesumspecified in respect of that cause or
those causes of action in thenotice of
payment;by giving notice in the form in schedule 1 to
every defendant to the action.(7)Where in an action against several
defendants sued jointly the plaintiffaccepts money
paid into court by any of those defendants in satisfaction
ofthe plaintiff’s cause of action against that
defendant then the action is stayedas against that
defendant only, but the sum paid into court shall be set offagainst any damages awarded to the plaintiff
against any other defendantagainst whom the
action is continued.(8)Where a party takes money out of court
in satisfaction of a cause ofaction for
defamation, the plaintiff or the defendant as the case may be,
mayapply to a Judge in chambers for leave to
make in open court a statement interms approved by
the Judge.(9)Wheretheplaintiffinanactionfordefamationagainstseveraldefendantssuedjointlyacceptsmoneypaidintocourtby1ofthedefendantsinsatisfactionofthecauseofaction,orallofthecausesofaction, in respect of which the plaintiff
claims, or if the plaintiff accepts asum or sums paid
in respect of 1 or more specified causes of action andgives
notice that the plaintiff abandons the action, the plaintiff may
after4 days from payment out and unless the court
or a Judge otherwise orders,tax his or her
costs incurred to the time of receipt of the notice of
paymentinto court (including the expenses of taking
the money out) and 48 hoursafter taxation
may sign judgment for his or her taxed costs.(10)The
Court or Judge in exercising discretion as to costs shall, to
theextent the Court or Judge sees fit, take into
account any payment of money
269Rules of the Supreme Courtinto
court and the amount of the payment.(11)If
any money paid into court is not accepted in accordance withsubrule(6)themoneyremainingincourtshallnotbepaidoutexceptpursuant to an
order of the Court or a Judge which may be made at anytime
before, at or after the trial or hearing of the action; and where
the orderis made before the trial or hearing the money
shall not be paid out except insatisfaction of
the cause or causes of action in respect of which it was
paidin.(12)When money paid
into court is liable to be paid out payment shallbe to
the party who is entitled or on the party’s written authority to
his orher solicitor, but with leave of the Court or
a Judge the money may be paidto the party’s
solicitor without the party’s written authority.˙Disposal of money in court3.(1)Anapplicationforpaymentoutofcourtofmoneypaidintoordeposited in court in a proceeding to which
these rules apply shall be servedon all other
parties.(2)A person who applies for payment out
of court of money paid into ordeposited in
court in a proceeding to which these rules apply shall statewhether the person is aware of a right or a
claim made by any other personto all or part of
that money.(3)Exceptasprovidedotherwisebytheserulesmoneypaidintoordeposited in court shall be dealt with in
accordance with theCourtFundsAct
1973.†2. Admiralty
actions˙Payment out of court to be on order
only7.Money paid into court in an admiralty
action shall not be paid out ofcourt except in
pursuance of an order of the Court or a Judge.˙Caveat
against payment out of court8.A
person desiring to prevent the payment of money out of court in
an
270Rules of the Supreme Courtadmiralty action must file a notice objecting
to the payment, and thereupon acaveat shall be
entered in the caveat payment book.˙Liability for delaying payment9.The party at whose instance a caveat
payment is entered, shall be liableto be condemned
in the costs and damages occasioned thereby, unless theparty
shows to the satisfaction of the Court or Judge good and
sufficientreason for entering the caveat.˙Tender to be accompanied by payment
into court10.In an admiralty action a party
desiring to make a tender in satisfactionof the whole or
any part of the adverse party’s claim, shall pay into court
theamount tendered by the party, and shall file
a notice of the terms on whichthe tender is
made.˙Acceptance or rejection of
tender11.Within 8 days after the filing of the
notice, the adverse party shall filea notice stating
whether the adverse party accepts or rejects the tender, and
ifthe adverse party does not do so, the adverse
party shall be deemed to haverejected
it.˙Suspension of proceedings12.Pending the acceptance or rejection of
a tender, the proceedings in theaction shall be
suspended.†ORDER 47—EXECUTION˙Judgment or order to be obeyed without
demand1.When any person is by any judgment or
order directed to pay anymoney, whether by way of debt, costs,
damages, or otherwise, or to deliveruportransferanypropertyrealorpersonaltoanother,itshallnotbe
271Rules of the Supreme Courtnecessary to make any demand of performance
of the judgment or order,but the person so directed shall be
bound to obey such judgment or orderupon being duly
served with the same without demand.˙Waiver
of conditional judgment or order2.Whenanypersonwhohasobtainedanyjudgmentororderuponcondition does not perform or comply with
such condition, the person shallbe considered to
have waived or abandoned such judgment or order so farasthesameisbeneficialtohimselforherself;andanyotherpersoninterestedinthemattermay,onbreachornon-performanceofthecondition, take either such proceedings
as the judgment or order may insuch case
warrant, or such proceedings as might have been taken if no
suchjudgment or order had been made, unless the
Court or a Judge otherwisedirects.˙Enforcing judgment for payment of
money3.Ajudgmentororderforthepaymentofmoneytoanyperson,whether by way of
debt, damages, costs, or otherwise, may be enforced bywrit
of fieri facias or writ of elegit, or, in cases in which that writ
is by lawallowed, by writ of capiasad
satisfaciendum, or, in the cases hereinaftermentioned, by the appointment of a receiver
of any moneys payable to theperson against
whom the judgment is given.˙For
delivery of land4.A judgment or order for the recovery
of land, or for the delivery of thepossession of
land, may be enforced by writ of possession.˙For
recovery of other property5.Ajudgmentororderfortherecoveryofanypropertyotherthanmoney or land may
be enforced by writ of delivery or writ of sequestration,or by
attachment.
272Rules of the Supreme Court˙For performance of an act6.A judgment or order for the payment of
money into court, or for theperformance of a
judgment, order, or writ, by which any person is requiredto do
any act other than the payment of money to some person, may
beenforced by writ of attachment or writ of
sequestration.˙For payment of alimony or maintenance
or costs6A.(1)A judgment or
order for the payment of any sum in respect ofalimonyorthemaintenanceofchildren,orforthepaymentofcostsincidentaltoorconsequentuponanysuchjudgmentororder,maybeenforced by writ of attachment.(2)This rule applies to any such judgment
or order, whether made beforeor after the date
of this rule.(3)This rule shall not take away or
curtail any right heretofore existing toenforce or give
effect to any such judgment or order.˙Judgment to abstain from any act7.A judgment or order requiring any
person to abstain from doing anyact may be
enforced by committal.˙Undertakings8.(1)An
undertaking to do any act other than the payment of money tosome
person may be enforced in the same manner as a judgment
requiringa person to do an act, and an undertaking to
abstain from doing an act maybe enforced in
the same manner as a judgment requiring a person to abstainfrom
doing an act.(2)In the case of non-performance of an
undertaking to pay money toany person, the
Court or a Judge may make an order for payment of themoney, which may be enforced in the manner
prescribed by rule 3.˙Meaning of “writ
of execution” etc.9.In these rules—
273Rules of the Supreme Court“issuingexecution”meanstheissuingofanysuchprocessagainsttheperson or property of a party as is
applicable to the case under theserules.“writ
of execution”includes writs of fieri facias, elegit,
capias, attachment,sequestration, and all subsequent writs that
may issue for giving effectthereto.˙Execution of judgment on
condition10.(1)When a judgment
or order is to the effect that any party is entitledtoanyreliefsubjecttooruponthefulfilmentofanyconditionorcontingency, the party so entitled may, upon
the fulfilment of the conditionor contingency,
and upon demand made upon the party against whom theparty
is entitled to relief, apply to the Court or a Judge for leave to
issueexecution against such party.(2)And the Court or Judge may, if
satisfied that the right to relief hasarisen according
to the terms of the judgment or order, order that executionissue
accordingly, or may direct that any issue or question necessary for
thedetermination of the rights of the parties be
tried in any manner in whichany question or
issue of fact in an action may be tried.˙When
writ issued11.A writ of execution shall not be
issued unless the officer is satisfiedthat the proper
time has elapsed to entitle the party suing out the same tohave
execution.˙Endorsement on writ of execution12.Every writ of execution shall be
endorsed with the name and addressof the party
suing it out, or the party’s solicitor, in the same manner as
awrit of summons in an action.˙Date and form of writ13.(1)Every writ of
execution shall bear date of the day on which it isissued.
274Rules of the Supreme Court(2)Theformsinschedule1shallbeused,withsuchvariationsascircumstances may require.˙Affidavit of debt in certain
cases14.(1)An affidavit of
debt shall be filed before the issue of a writ ofexecution or renewed writ of execution upon
any judgment by default, orupon a judgment
entered on a warrant of attorney or cognovit actionem, orupon
a judgment entered more than 1 year before the issue of the
writ.(2)If the plaintiff is absent from the
State the affidavit may be made bythe plaintiff’s
solicitor, or by his or her agent in Queensland.˙Expenses of execution15.In every case of execution the party
entitled to execution may levy thetaxed costs of
the writ of execution, and the poundage, fees, and expensesof
execution, over and above the sum recovered.˙Costs
of execution16.The plaintiff may endorse on a writ of
execution a direction to levythe sum
prescribed in schedule 2, part 16 for costs of the writ, which
sumshall not be subject to taxation.˙Amount of money and interest to be
recovered to be endorsed17.Every writ of
execution for the recovery of money shall be endorsedwith
a direction to the sheriff, or other officer or person to whom the
writ isdirected,tolevythemoneyreallydueandpayableandsoughttoberecovered under the judgment or order,
stating the amount, and also to levyinterest thereon,
if sought to be recovered, at the rate prescribed from timeto
time pursuant to theCommon Law Practice Act 1867,
section 73 or atsuch other rate ordered by the Court pursuant
to that section, from the timewhen the judgment
or order was entered or made, together with the costs ofthe
writ.
275Rules of the Supreme Court˙Time to sue out fi. fa., elegit, ca.
sa., writ of possession or delivery18.(1)Apartymaysueoutawritoffierifacias,elegit,capiasadsatisfaciendum, possession, or
delivery, at any time after the date of thejudgment or order
in the party’s favour.(2)However, if the
judgment or order is for payment within a periodtherein mentioned, the writ shall not be
issued until after the expiration ofsuch
period.(3)In addition, the Court or a Judge may,
at or after the time of givingjudgment or
making an order, stay execution until such time as the Court
orJudge may think fit.˙Time
for execution except for money or costs19.A
party shall not be entitled to sue out any other writ of
executionuntil after the expiration of 14 days from
the date of the judgment or order,without the leave
of the Court or a Judge.˙Execution of
judgment for money and costs20.Upon
a judgment or order for the payment of a sum of money andcosts, the party entitled thereto may sue
out, at the party’s election, either1 writ or
separate writs of execution for the money and for the costs; but
asecond writ shall be for costs only, and
shall be issued not less than 8 daysafter the first
writ.˙Renewal of writ21.A
writ of execution, if unexecuted, shall remain in force for 1
yearonly from its issue, unless renewed in the
manner hereinafter provided; but,at any time
before its expiration, any such writ may, by leave of the
Courtor a Judge, be renewed by the party suing it
out for 1 year from the date ofsuch renewal, and
so on from time to time during the continuance of therenewed writ, either by being marked with the
word ‘renewed’ and with aseal bearing the date of the day,
month, and year of renewal, or by suchparty giving a
written notice of renewal to the sheriff, signed by the party
orthe party’s solicitor, and bearing the like
office seal; and a writ of execution
276Rules of the Supreme Courtso
renewed shall have effect, and shall be entitled to priority,
according tothe time of the original delivery
thereof.˙Evidence of renewal22.The
production of a writ of execution, or of the notice renewing
thesame,purportingtobemarkedwithsuchsealasinrule21mentioned,showing the same
to have been renewed, shall be sufficient evidence of itshaving been so renewed.˙Execution to issue within 6 years23.As between the original parties to a
judgment or order, executionmay be issued at
any time within 6 years from the date of the judgment ororder.˙Leave
to issue execution in certain cases24.(1)In
the following cases, that is to say—(a)when6yearshaveelapsedsincethedateofthejudgmentororder, or any change has taken place by
death or otherwise in theparties entitled or liable to
execution;(b)when a husband is entitled or liable
to execution upon a judgmentor order for or
against his wife;(c)whenapartyisentitledtoexecutionagainstanyoftheshareholdersofacompanyuponajudgmentrecordedagainstsuchcompany,oragainstapublicofficerorotherpersonrepresenting such company;the
party claiming to be entitled to execution may apply to the Court
or aJudge for leave to issue execution
accordingly.(2)And the Court or Judge may, if
satisfied that the party so applying isentitled to
execution, make an order giving the party leave accordingly,
ormay order that any question or issue of fact
necessary for determining therights of the
parties shall be tried in any manner in which any question
orissue of fact in an action may be
tried.
277Rules of the Supreme Court(3)And in either case the Court or Judge
may impose such terms as tocosts or
otherwise as may be just.˙Enforcement of
orders25.Every order of the Court or a Judge in
any cause or matter may beenforcedagainstallpersonsboundtherebyinthesamemannerasajudgment to the
same effect.˙Execution by or against a person not a
party26.Any person, not being a party to a
cause or matter, who obtains anyorder, or in
whose favour any order is made, shall be entitled to enforceobedience to such order by the same process
as if the person were a party tosuch cause or
matter; and any person not being a party to a cause or
matter,against whom obedience to any judgment or
order may be enforced, shallbe liable to the
same process for enforcing obedience to such judgment ororder
as if the person were a party to such cause or matter.˙Saving of pre-existing mode of
process27.Nothing in this order shall take away
or curtail any right heretoforeexisting to
enforce or give effect to any judgment or order in any manner
oragainst any person or property
whatsoever.˙Order of issue of writs28.Nothinginthisordershallaffecttheorderinwhichwritsofexecution may be issued.˙Court may order act to be done at
expense of party refusing29.If a mandamus,
granted in an action or otherwise, or a mandatoryorder, injunction, or judgment for the
specific performance of any contract,isnotcompliedwith,theCourtoraJudge,inadditiontoorinsteadofproceedings against the disobedient party for
contempt, may direct that theact required to
be done may be done so far as practicable by the party bywhom
the judgment or order has been obtained, or by some other
person
278Rules of the Supreme Courtappointed by the Court or Judge for the
purpose, and may order that theexpenses incurred
in doing it shall be paid by the disobedient party: and,upon
the act being done, such expenses may be ascertained in such
manneras the Court or a Judge may direct, and
execution may issue for the amountso ascertained,
and costs.˙Enforcing judgment or order against
corporation30.When a judgment or order requiring a
corporation to do or abstainfrom doing any
act is disobeyed, the party in whose favour the judgment ororder
was given or made may, by leave of the Court or a Judge, enforce
thesame by writ of sequestration against the
corporate property, or by writ ofattachmentorsequestrationagainstthedirectorsorotherofficersofthecorporation, or
by committal of such directors or officers, according to thenature of the disobedience.˙Return of writ31.(1)No
order shall issue for the return of any writ, or to bring in
thebody of a person ordered to be attached or
committed; but a notice to thesheriff by the
solicitor of the party at whose suit the writ was issued, or
theorder for attachment or committal was
obtained, or by the party personallyif the party sues
or appears in person, requiring the sheriff to return suchwrit
or to make the sheriff’s report or to bring in the body within a
specifiedtime, shall, if not complied with, entitle
such party to apply for an order forthe attachment of
the sheriff.(2)The time specified in the notice shall
not be less than 8 days.(3)Any such notice
may be given in vacation as well as at any othertime.˙Enforcing award32.TheCourtoraJudgemay,uponsuchtermsastosecurityorotherwise as may be just, allow an award to
be enforced at any time thoughthe time for
moving to set it aside has not elapsed.
279Rules of the Supreme Court†Discovery in aid of execution˙Examination of judgment debtor as to
debts owing to him or her33.Whenajudgmentororderisgivenormadeforthepaymentofmoney, the party entitled to enforce it may
apply ex parte to the Court or aJudge for an
order that the debtor liable under such judgment or order, or,
inthe case of a corporation or company, or
other body of persons empoweredby law to sue or
be sued, whether in its own name or in the name of anyofficer or other person, that any officer
thereof be orally examined before aJudge or an
officer of the Court as the Court or Judge may appoint, as
towhether any and what debts are owing to the
debtor, and whether the debtorhas any and what
other property or means of satisfying the judgment ororder; and the Court or Judge may make an
order for the attendance and theexamination of
such debtor, or of such officer, and for the production byhim
or her of any books or documents.˙Difficulty in enforcing judgment34.In the case of a judgment or order for
relief other than the payment ofmoney, if any
difficulty arises in or about the execution or enforcementthereof, the Court or a Judge may, on the
application of any party interestedin such execution
or enforcement, make such order for giving effect to thejudgmentororderasmaybejust;andmaymakeanorderfortheattendance and examination of any party
or other person as to any matterconcerning such
execution or enforcement.˙Costs of
application under rr 33 and 3435.The
costs of any application under rules 33 and 34, or either of
them,and of any proceedings arising from or
incidental thereto, shall be in thediscretion of the
Court or a Judge.
280Rules of the Supreme Court†Execution by appointment of
receiver˙When receiver may be appointed36.When it is impracticable to enforce
payment of money payable undera judgment or
order otherwise than by appointment of a receiver, the CourtoraJudgemayappointareceivertoreceiveanymoneypayabletotheperson by whom
the payment is adjudged or ordered to be made, and topaythesametothepersoninwhosefavourthejudgmentororderwasgiven
or made.˙Conditions of appointment of
receiver37.(1)When an
application is made for the appointment of a receiver forthe
purpose of enforcing payment of money payable under a judgment
ororder, the Court or Judge, in determining
whether it is just or convenientthat such
appointment should be made, shall have regard to the amount
ofthedebtclaimedbytheapplicant,theamountwhichmayprobablybeobtained by the receiver, and the probable
expenses to be incurred by his orher appointment,
and may direct any inquiries as to the matters aforesaid, oras to
any other matters, before making the appointment.(2)Theprovisionsoforder58relatingtoreceiversshallapplytoreceivers so appointed.†ORDER 48—WRITS OF FIERI FACIAS,
ELEGIT,AND SEQUESTRATION†1.
Effect of writs˙Effect and manner of execution of writs
of fi. fa. and elegit1.Writs of fieri
facias and of elegit shall have the same force and effectas
the like writs have heretofore had, and shall, except as hereby
otherwise
281Rules of the Supreme Courtprovided,beexecutedinthesamemannerinwhichthelikewritshaveheretofore been
executed.˙Writ of venditioni exponas2.Whenitappears,uponthereturnofawritoffierifacias,thatthesheriff or other officer has by virtue of
such writ seized, but has not sold,anygoodsofthepersondirectedtopayasumofmoneyorcosts,theperson to whom such sum of money or costs is
payable shall, immediatelyafter such writ and return have been
filed, be at liberty to sue out a writ ofvenditioni
exponas.˙Writs in aid of
fi. fa. or elegit3.Writs ofvenditioniexponas, and all other
writs in aid of a writ of fierifacias or a writ
of elegit, may be issued and executed in the same cases andin
the same manner as heretofore.˙Sequestration to enforce payment into court,
or doing of other acts4.(1)Whenanypersonisbyanyjudgmentororderdirectedtopaymoney into court
or to do any other act in a limited time, and after dueserviceofsuchjudgmentororderrefusesorneglectstoobeythesameaccording to the
exigency thereof, the person prosecuting such judgment ororder
shall, at the expiration of the time limited for the performance
thereof,be entitled, without obtaining any order for
that purpose, to issue a writ ofsequestration
against the estate and effects of such disobedient person.(2)Such writ of sequestration shall have
the same effect as a writ ofsequestration
heretofore had, and the proceeds of such sequestration may
bedealt with in the same manner as the proceeds
of writs of sequestration haveheretofore been
dealt with by the Court.(3)Awritofsequestrationtoenforcepaymentofcostsshallnotbeissued without
the leave of the Court or a Judge.˙No
subpoena for costs5.No subpoena for the payment of costs
shall be issued.
282Rules of the Supreme Court†2. Sales under writs of fieri
facias˙Application for order for private
sale—sheriff’s list6.(1)Inanycaseinwhichexecutionbyfierifaciashasbeenissuedagainst any person, either party may apply to
a Judge for an order that thesale under the
execution shall be made otherwise than by public auction.(2)In any such case the sheriff shall, at
the request of either party furnishhim or her with a
list of the names and addresses of every person at whosesuit
any other writ of execution against the property of the same person
hasbeen lodged with the sheriff (the“sheriff’s list”).˙Summons7.(1)The
summons shall contain a short statement of the grounds of
theapplication, and shall be served on the
following persons—(a)if the applicant is an execution
creditor—upon the sheriff, andupon every
person named in the sheriff’s list;(b)iftheapplicantistheexecutiondebtor—upontheexecutioncreditor at
whose suit the execution has been levied under whichthe
sale is intended to be made, the sheriff, and every other
personnamed in the sheriff’s list.(2)The summons shall be served 4 clear
days before the day on which itis
returnable.˙List8.Onthehearingoftheapplicationtheapplicantshallproducethesheriff’s list to the Judge.˙Hearing9.The
sheriff and every other person on whom the summons has beenserved may attend the hearing of the
application and be heard in oppositionto or in support
of the application.
283Rules of the Supreme Court˙Costs10.The
Judge may, at the hearing of the summons, make such order asto
the mode of sale as may be just, or may direct that all or any part
of thecosts shall be borne by any of the persons
attending, or otherwise as may bejust.˙Order of sale11.The
person against whom an execution under which any property isto be
sold is issued may point out which description of property,
whetherreal or personal, and what part or parts
thereof, the person desires to havefirst sold, and
in what order, and the sale shall be made accordingly; but
ifthe proceeds of part are not sufficient to
satisfy the execution, the sheriffshall proceed
forthwith to sell the remainder or such part thereof as shall
besufficient to satisfy the execution, in the
order so pointed out.˙Advertisements12.When
any property is to be put up for sale by the sheriff, the
sheriffshallcausenoticeofthetimeandplaceofsale,andparticularsoftheproperty, to be given by advertisement
in 1 or more newspapers publishedwithinthecourtdistrictinwhichtheexecutionwasissued;and,iftheproperty is
situated, or the sale is to be held, at a distance of more
than35 km from the registry from which the
execution issued, the sheriff shallcause further
notice to be given by advertisement in 1 or more of the
nearestlocalnewspapers;and,ifthereisnolocalnewspaperpublishedwithin35 km
of the situation of the property, the sheriff shall cause such
furthernotice to be given by affixing the same on
the property or the premiseswhere the
property is, or in some public place or places near to the
intendedplace of sale, or in both places, as the case
may be.˙Interpretation13.In
rules 6 to 12—“sheriff”includes any
officer charged with the execution of any writ ofexecution.
284Rules of the Supreme Court†ORDER 49—ATTACHMENT OF DEBTS˙Order for attachment of debts1.Any person who has obtained a judgment
or order for the payment ofmoney by any
other person may, either before or after any oral
examinationof the person by whom the payment is adjudged
or ordered to be made (the“debtor”) and upon
affidavit by himself, herself or the person’s solicitor,or
any other person who can swear to the facts, showing that the
judgmenthas been recovered, or the order made, and
that it is still unsatisfied, inwhole or in part,
and that any other person is indebted to the debtor, and iswithin the jurisdiction, apply to the Court
or a Judge or registrar ex parte foran order
(a“garnishee order”) that all debts
owing or accruing from suchother person
(“the garnishee”) to such debtor
shall be attached to answerthe judgment or
order, together with the costs of the garnishee proceedings,and
the Court or Judge or registrar may make an order accordingly; and
bythe same or any subsequent order it may be
ordered that the garnishee shallappearbeforetheCourtoraJudgeorregistrartoshowcausewhythegarnishee should
not pay to the person who has obtained such judgment ororder
the debt due from the garnishee to such debtor, or so much thereof
asmay be sufficient to satisfy the judgment or
order, together with the costsaforesaid.˙Effect of order2.(1)Noticeofeverysuchordershallbegiventothegarnisheebyservice thereof on the garnishee, either
personally or in such other manneras the Court or a
Judge or registrar may direct.(2)And,
upon such notice being given, all debts owing or accruing
fromthe garnishee to the debtor shall be attached
in his or her hands.˙Execution against
garnishee3.(1)Thegarnisheemaypayintocourttheamountduefromthegarnishee to the debtor, or an amount equal
to the amount payable under thejudgment or
order.(2)If the garnishee does not do so, but
appears in pursuance of the order,
285Rules of the Supreme Courtand
does not dispute the debt due or claimed to be due from the
garnishee tosuch debtor, or if the garnishee does not
appear in pursuance of the order,the Court or
Judge may order that execution be issued against the
garnishee,andexecutionmaybeissuedaccordingly,withoutanypreviouswritorprocess,tolevytheamountduefromthegarnisheetothedebtor,orsomuch thereof as may be sufficient to
satisfy the judgment or order, togetherwith the costs of
the garnishee proceedings.˙Trial of liability
of garnishee4.If the garnishee disputes his or her
liability, the Court or Judge, insteadofmakinganorderthatexecutionshallbeissued,mayorderthatanyquestion or issue of fact necessary for
determining the garnishee’s liabilityshall be tried in
any manner in which any question or issue of fact in anaction may be tried.˙Lien
or claim of third person on debt5.If
it is suggested by the garnishee, or otherwise appears, that the
debtsought to be attached belongs to some third
person, or that any third personhas a lien or
charge upon it, the Court or Judge may order such third
personto appear and state the nature and
particulars of his or her claim upon suchdebt.˙Trial of claim of third person and
order thereon or onnon-appearance6.After hearing any such third person who
appears under such order asinrule5mentioned,andanyotherpersonwhointhesameoranysubsequentordertheCourtoraJudgemayordertoappear,orintheabsenceofsuchthirdpersonifthethirdpersondoesnotappearwhenordered, the Court or Judge may order
execution to be issued against thegarnishee to levy
the amount due from the garnishee to the debtor, or somuch
thereof as may be sufficient to satisfy the judgment or order,
togetherwith the costs of the garnishee proceedings,
or may order any question orissue of fact to
be tried as provided by rule 4, and may bar the claim of anysuch
third person, or may make such other order as the Court or Judge
may
286Rules of the Supreme Courtthink
fit, upon such terms, in all cases, with respect to the lien or
charge (ifany) of any such third person, and to costs,
as may be just.˙Payment by or execution on garnishee a
valid discharge7.Payment made by, or execution levied
upon, the garnishee under anysuch proceedings
as aforesaid shall be a valid discharge to the garnishee asagainst the debtor to the extent of the
amount paid or levied, although suchproceeding may be
afterwards set aside, or the judgment or order reversed.˙Costs of proceedings8.(1)The costs of any
application for an attachment of debts and of anyproceedings arising from or incidental to
such application shall be in thediscretion of the
Court or Judge.(2)The costs of the judgment creditor of
the garnishee proceedings shall,unless otherwise
directed, be retained out of the money recovered by thejudgment creditor under the garnishee order,
and in priority to the amountof the money due
under the judgment or order.(3)The
Court or Judge may order the creditor to pay the costs of
thegarnishee and may allow him or her to add
them to his or her own costs ofthe garnishee
proceedings.†ORDER 50—CHARGING
ORDERS—EXECUTIONAGAINST FUNDS IN COURT˙Charging orders1.Any
person who has obtained a judgment or order for the payment
ofmoney by any other person may apply to a
Judge for an order, under theCommonLawPracticeAct1867,sections49and50,charginganyannuities, funds, stock, or shares of
the person by whom the payment isadjudgedororderedtobemade(the“debtor”)inanypubliccompanywhether
incorporated or not, or any deposit standing to the credit of
thedebtor, or to the credit of any person in
trust for the debtor, in any bank in
287Rules of the Supreme CourtQueensland, or any equitable interest of the
debtor in any property whichcannot be taken
in execution, and the Judge may make an order accordingly.˙Mode of application2.The
order may be made on summons upon notice, or may be made exparte
in the first instance by an order calling on the debtor to show
cause.˙Mode of enforcing charge3.Proceedings to enforce such charge may
be taken at any time after theexpiration of 3
months from the date of the order, and shall be taken byaction.˙Discharge of order4.Anapplicationtovaryordischargeachargingordermadeunderrules
1 to 3 shall be made by summons.˙Charge
on partnership property5.AsummonsforanorderchargingtheinterestofapartnerinthepartnershippropertyandprofitsunderthePartnershipAct1891,section 26, or for any such other order as is
thereby authorised to be made,shall be served
on the judgment debtor and on his or her partners, or suchof
them as are within the jurisdiction; and such service shall be good
serviceonallthepartners;andallordersmadeonanysuchsummonsshallbesimilarly served.˙Applications by partners of debtor6.Any application made by any partner of
the judgment debtor under thesamesectionshallbemadebysummons,whichshallbeservedontheperson by whom the charging order was
obtained, and on the debtor, andon such of the
other partners as do not concur in the application and arewithin the jurisdiction; and such service
shall be good service on all thepartners;andallordersmadeonanysuchsummonsshallbesimilarlyserved.
288Rules of the Supreme Court˙Enforcement of charge7.Proceedings to enforce a charge
created under rules 5 and 6 shall be bysummons in the
same cause or matter.˙Execution against
money in court8.When any person against whom a
judgment or order for the paymentof money has been
given or made is entitled in the person’s own right toany
money standing to the credit of any cause or matter in court, the
Courtor a Judge, upon the application of the party
who has obtained the judgmentor order, may
order that the money shall be applied so far as it will
extendin satisfaction of the amount payable under
the judgment or order, and paidto the person
entitled thereunder accordingly.˙Mode
of application9.An order under rule 8 may be made on
summons, or the Judge maymake an order ex parte in the first
instance charging the money in court, andcalling on the
person by whom the payment is adjudged or ordered to bemadetoshowcausewhyitshouldnotbepaidtothepartywhohasobtained the judgment or order.†ORDER 51—WRITS OF POSSESSION˙Writ of possession for recovery of
land1.Awritofpossessionshallhavethesameeffectasthewritofpossession heretofore used in actions
of ejectment in the Supreme Court.˙Writ
obtained on proof of service of judgment, and default2.When by any judgment or order any
person therein named is directedtodeliveruppossessionofanylandtosomeotherperson,thepartyprosecuting such
judgment or order shall be entitled, without any order
for
289Rules of the Supreme Courtthat
purpose, to sue out a writ of possession on filing an affidavit
showingthat the judgment or order has been duly
served and has not been obeyed.˙Execution on judgment for recovery of land
and costs3.Upon a judgment or order for the
recovery of any land and costs, thesuccessfulpartymay,athisorherelection,sueouteither1writofexecution for the recovery of possession and
for the costs, or separate writsfor the recovery
of possession and for the costs.˙Writ
of restitution4.When, after possession of land has
been given to any person under awritofpossession,anyotherpersonwrongfullytakespossessionoftheland, the Court or a Judge may direct
that a writ or writs of restitution beissued to restore
possession of the land to the party to whom possessionwas
so given in the first instance.†ORDER 52—WRITS OF DELIVERY˙Writ of delivery for recovery of
property other than land or money1.When
it is sought to enforce a judgment or order for the recovery
ofany property other than land or money by writ
of delivery, the Court or aJudge may, upon
the application of the party entitled to delivery, order
thatexecution shall issue for the delivery of the
property, without giving theother party the
option of retaining the property on payment of the assessedvalue
(if any) and that if the property cannot be found, the sheriff
shall,unless the Court or a Judge otherwise orders,
distrain the other party by allhis or her lands
and chattels in the sheriff’s bailiwick, until the other
partydelivers the property; or, at the option of
the party entitled to delivery, thatexecution shall
issue to recover the assessed value (if any) of the
property.
290Rules of the Supreme Court˙Separate writ for damages, costs, and
interest2.When a writ of delivery is directed to
be issued, the successful partymay, at his or
her election, include execution for the damages (if any) andcosts
awarded, in the same writ, or may sue out a separate writ or writs
ofexecution for the damages and costs, or for
the costs only.˙Form of writ3.Writsofdeliveryshallbeintheforminschedule1,withsuchvariations as circumstances may
require.˙Writ of delivery in aid of
receiver4.When by any order any person therein
named is directed to deliver uppossession of any
property, other than land or money, to a receiver, theparty
prosecuting such order shall be entitled, without any order for
thatpurpose, to sue out a writ of delivery, on
filing an affidavit showing that theorder has been
duly served and has not been obeyed.†ORDER 53—ATTACHMENT AND COMMITTAL†1. Attachment˙Effect
of writ of attachment1.(1)Awritofattachmentshallhavethesameeffectasawritofattachment issued out of the Court in
its equitable jurisdiction heretoforehad.(2)The sheriff or other officer to whom
the writ of attachment is directedmay deliver the
party attached to the superintendent of any prison and suchsuperintendent shall receive the said party
attached and the party safely keepin the said
prison until such time as the Court or the sheriff or other
officershall direct.
291Rules of the Supreme Court˙Application for leave to issue writ of
attachment2.A writ of attachment shall not be
issued without the leave of the CourtoraJudge,tobeappliedforonnoticetothepartyagainstwhomtheattachment is to be issued.˙Evidence of disobedience3.The application for the writ must be
supported by an affidavit showingthat the party
against whom it is sought has been served with the judgmentor
order or writ (if any) sought to be enforced, either personally or
by somemode of substituted service specially
directed by the Court or a Judge orauthorised by
these rules, or that it has come to his or her knowledge, orthat
personal service has been waived by the party, or, in the case of
anundertaking, that the undertaking was duly
given by the party, and, in eithercase, that the
party has failed to obey the judgment, or order, or writ, or
toperform the undertaking.˙Court
may make peremptory order before issue of writ4.In
the case of non-performance of an undertaking the Court or a
Judgemay,inthefirstinstance,insteadofdirectingtheissueofawritofattachment,makeaperemptoryorderfortheperformanceoftheactundertaken to be
done.˙Corporations5.Rules 1 to 4 shall apply to the case of
writs of sequestration againstcorporationsfordisobediencetojudgmentsorordersbywhichtheyarerequired to do any act.†2. Committal˙Motion
for committal6.Applications for committal for
disobedience to a judgment or orderrequiring a
person to abstain from doing any act shall be made by
motion
292Rules of the Supreme Courtupon
notice, which must be served personally, unless the Court or a
Judgeauthorises substituted service.˙Corporations7.Applicationsforwritsofsequestrationagainstcorporationsfordisobedience to judgments or orders by which
they are required to abstainfrom doing any
act shall be made in the same manner.˙Order
84 to apply8.The provisions of order 84 relating to
committal for contempt of courtshall apply to
applications for committal, and to persons committed, fordisobediencetojudgmentsororders,andalso,sofarasthesameareapplicable, to corporations against whom a
writ of sequestration is issuedfor the like
cause.†ORDER 54—ACTIONS BY AND AGAINST
FIRMSAND PERSONS CARRYING ON BUSINESS INNAMES OTHER THAN THEIR OWN˙Actions by and against firms within the
jurisdiction1.Any2ormorepersonsclaimingorbeingliableascopartnersandcarrying on business within the jurisdiction
may sue or be sued in the nameof the respective
firms (if any) of which such persons were copartners at thetime
of the accruing of the cause of action.˙Disclosure of partners’ names2.When partners sue in the name of their
firm, the plaintiffs or theirsolicitorshall,ondemandinwritingbyoronbehalfofanydefendant,forthwith declare
in writing the names and places of residence of all thepersons constituting the firm in whose name
the action is brought; and if theplaintiffs or
their solicitor fail to comply with such demand, all
proceedings
293Rules of the Supreme Courtin
the action may be stayed upon such terms as the Court or a Judge
maydirect.˙Action
to continue in name of firm3.(1)Whenthenamesofthepartnersaredeclared,theactionshallproceedinthesamemanner,andthesameconsequencesinallrespectsshall follow, as
if they had been named as the plaintiffs in the originatingproceeding.(2)But
all the proceedings shall, nevertheless, continue in the name
ofthe firm.˙Order
for disclosure4.In any case in which partners sue or
are sued in the name of their firmunderrule1,anypartytothecausemayapplytoaJudgeforanorderdirecting that a
statement of the names and addresses of the persons whowere,
at the time of the accruing of the cause of action, copartners in
anysuchfirm,shallbefurnishedinsuchmanner,andverifiedonoathorotherwise, as the Judge may direct.˙Service5.(1)When
persons are sued as partners in the name of their firm underrule
1, the originating proceeding shall be served either upon some 1
ormore of the partners, or at the principal
place, within the jurisdiction, of thebusiness of the
partnership upon some person having at the time of servicethe
control or management of the partnership business there; and,
subject tothese rules, such service shall be deemed
good service upon the firm sosued, whether any
of the members thereof are out of the jurisdiction or not.(2)However, in the case of a
co-partnership which has been dissolved tothe knowledge of
the plaintiff before the commencement of the action, theoriginatingproceedingshallbeserveduponeverypersonwithinthejurisdiction sought to be made
liable.
294Rules of the Supreme Court˙Notice in what capacity served6.(1)When persons are
sued as partners, and the originating proceedingisservedasdirectedbyrule5,thereshallbedeliveredwithittoeverypersonuponwhomitisservedanoticeinwritingstatingwhetherthepersonisservedasapartnerorasapersonhavingthecontrolormanagement of the partnership business, or in
both characters.(2)In the absence of such notice, the
person served shall be deemed to beserved as a
partner.˙Appearance of partners7.When persons are sued as partners in
the name of their firm, they shallappearindividuallyintheirownnames;butallsubsequentproceedingsshall,
nevertheless, continue in the name of the firm.˙No
appearance except by partners8.When
a writ is served under rule 5 upon a person having the control
ormanagement of the partnership business, an
appearance by the person shallnot be necessary
unless the person is a member of the firm sued.˙Appearance under protest of person served as
partner9.Any person served as a partner under
rule 5 may enter a conditionalappearance,
denying that he or she is a partner, but such appearance
shallnotprecludetheplaintifffromdulyservingthefirmotherwisethanbyservice upon the person, and obtaining
judgment against the firm in defaultof appearance if
no partner enters an appearance in the ordinary form.˙Execution of judgment against a
firm10.(1)Whenajudgmentororderisgivenormadeagainstafirm,execution may
issue—(a)against any property of the
partnership within the jurisdiction;(b)against any person who has appeared in the
action in the person’sown name or who has admitted on the
pleadings that the personis, or who has been adjudged to be, a
partner;
295Rules of the Supreme Court(c)against any person who has been
individually served, as a partner,with the writ of
summons, and has failed to appear.(2)If
the party who has obtained the judgment or order claims to
beentitled to issue execution against any other
person as being a member ofthe firm, the
party may apply to the Court or a Judge for leave so to do;
andthe Court or Judge may give such leave if the
liability of such other personis not disputed,
or, if such liability is disputed, may order that the liability
ofsuch person be tried in any manner in which
any question or issue of fact inan action may be
tried.(3)But, except as against any property of
the partnership, a judgmentagainst a firm
shall not render liable, or release, or otherwise affect,
anymemberthereofwhowasoutofthejurisdictionwhenthecausewascommenced, and who has not appeared in the
cause, unless the member hasbeen served
within the jurisdiction with the originating proceeding, or
theplaintiff has obtained liberty to proceed in
the action against the memberunder order
11.˙Attachment of debts owing from a
firm11.(1)The provisions
of order 49 as to attachment of debts shall apply tothe
attachment of debts owing or accruing from a firm carrying on
businesswithin the jurisdiction, although 1 or more
members of the firm may beresident abroad; and service of notice
of the garnishee order upon someperson having the
control or management of the partnership business orsomememberofthefirmwithinthejurisdictionshallbedeemedgoodservice on the firm.(2)An
appearance by any member of the firm pursuant to the
garnisheeorder shall have the same effect as
appearance by all the members of thefirm.˙Application of rules to actions between
copartners12.(1)This order shall
apply to causes between a firm and 1 or more ofits members, and
to causes between firms having 1 or more members incommon,providedthatsuchfirmorfirmscarryonbusinesswithinthejurisdiction.(2)But
execution shall not be issued in such causes without leave of
the
296Rules of the Supreme CourtCourt
or a Judge, and on an application for leave to issue such execution
allsuch accounts and inquiries may be directed
to be taken and made, anddirections given, as may be
just.˙Application of rules to person trading
as a firm13.Any person carrying on business within
the jurisdiction in a name orstyle other than
his or her own name may be sued in such name or style asif it
were a firm name; and, so far as the nature of the case will
permit, allthe rules of this order relating to
proceedings against firms shall apply toany such
case.†ORDER 55—ACTIONS ON PENAL BONDS˙Further breaches1.In
an action on a penal bond for the breach of any covenant
containedtherein in respect of which there may be
further breaches, the writ may beendorsed with a
claim for the amount of the penal sum mentioned in thebond,andjudgmentmaybeenteredfortheplaintiffforthatamountassecurity against further breaches, but
execution on the judgment shall belimited to the
amount of the damages which the plaintiff has sustained byreason of the breach or breaches of covenant
up to the time of the trial orother assessment
of damages, and costs.˙Ascertainment of
damages on further breaches2.(1)When a plaintiff
has obtained judgment for the amount of the penalsum
mentioned in a bond under rule 1, the Court or a Judge may,
uponaffidavit showing that since the judgment was
obtained further breacheshave been committed, order that any
damages sustained by the plaintiff byreason of the
said further breaches shall be assessed in such way as theCourt
or Judge may direct, and by the same or any subsequent order
mayorder that execution limited to the amount of
such damages and costs so tobe ascertained
shall be issued on the original judgment.
297Rules of the Supreme Court(2)However, the plaintiff shall not in
any case recover in all, by way ofdamages, more
than the amount of the penalty mentioned in the bond.˙No statement of claim when defendant
does not appear3.(1)Ifinanysuchactionthedefendantfailstoappeartothewrit,judgment may be
entered as provided in order 15 and rule 1 of this order.(2)The plaintiff may thereupon apply to
the Court or a Judge ex parte foran order for the
assessment of damages sustained in respect of breaches ofcovenant up to the time of assessment, and
may afterwards, from time totime, proceed as
mentioned in rule 2.˙Payment into court
limited to particular breaches4.When
the writ of summons in an action is endorsed with a claim
forthe full amount of any penal sum mentioned in
a bond, payment into courtshall be made with respect to
particular breaches only, and not with respectto the whole
claim.†ORDER 56—PENAL ACTIONS˙Leave to compound penal action1.Leave to compound a penal action shall
not be given in cases wherepart of the
penalty goes to the Crown, unless notice has first been given
tothe Attorney-General; but in other cases it
may be given without notice toany
officer.˙Undertaking by defendant2.The order giving leave to compound a
penal action shall contain anundertaking by
the defendant to pay the sum for which the Court or Judgegives
leave to compound the action.
298Rules of the Supreme Court˙Queen’s half of composition3.When leave is given to compound a
penal action in a case where partof the penalty
goes to the Crown, the Queen’s half of the composition shallbe
paid to the Treasurer.†ORDER 57—ACTIONS
FOR MANDAMUS ANDINJUNCTION˙Claim
for mandamus or injunction to be endorsed on writ1.When the plaintiff in an action claims
a mandamus or an injunction,the plaintiff
must endorse his or her claim upon the writ of summons in
theform in schedule 1, or to the like
effect.˙Trial of action2.Whentheonlyreliefclaimedintheactionisamandamusorinjunction, with or without a declaration,
the plaintiff may at any time afterappearance, or in
default of appearance, apply to the Court by motion onaffidavit for the relief to which the
plaintiff claims to be entitled, and on thehearing of the
motion the Court may give judgment in the action, or maydirect that pleadings shall be delivered, and
that the action shall be broughtto trial as in
other cases.˙Time for performance of duty3.(1)Whenjudgmentisgivenfortheplaintiffinanactionforamandamus,theCourtmaybythejudgmentcommandthedefendanttoperform the duty in question either forthwith
or on the expiration of suchtime and on such
terms as the Court may think fit.(2)The
Court or a Judge may extend the time limited by the judgmentfor
the performance of the duty ordered to be performed.
299Rules of the Supreme Court˙Mandamus or injunction to be by
judgment or order4.(1)No writ of
mandamus or injunction shall be issued in an action.(2)The command or injunction shall be
expressed in the judgment ororder, and any
such judgment or order shall have the effect which a writ ofmandamus or injunction formerly had.†ORDER 58—INSPECTION OFPROPERTY—INTERIM PRESERVATION,CUSTODY, AND MANAGEMENT OFPROPERTY—RECEIVERS—STOP ORDERS†1. Interim preservation, custody, and
management of property˙Inspection,
detention, or preservation of property the subject of anaction1.The
Court or a Judge may, upon the application of any party to a
causeor matter, and upon such terms as may be
just, make any order that may benecessary for the
inspection, detention, or preservation, of any property orthing, being the subject matter of the
litigation, or as to which any questionmay arise
therein, and for all or any of the purposes aforesaid may
authoriseany person to enter upon or into any land or
building in the possession ofany party to such
cause or matter, and for all or any of such purposes mayauthoriseanysamplestobetaken,oranyobservationtobemadeorexperimenttobetried,whichmaybenecessaryorexpedientforthepurpose of obtaining full information
or evidence.˙Inspection by Judge2.Any
Judge by whom any cause or matter is heard or tried, with orwithout a jury, or before whom any cause or
matter is brought by way ofappeal, may
inspect any property or thing concerning which any questionmay
arise therein.
300Rules of the Supreme Court˙Inspection by jury3.(1)The
provisions of rule 1 as to inspection shall apply to
inspectionby a jury, and in such case the Court or a
Judge may make all such ordersupon the sheriff
or other proper officer as may be necessary to procure theattendance of the jury at such time and
place, and in such manner, as theCourt or Judge
may think fit.(2)TheCourtorJudgeshallbytheordermakesuchprovisionastodefraying the expenses of the
inspection as may be just.˙Preservation or
interim custody of subject matter of disputed contract4.When a prima facie case of liability
under a contract is established, theCourt or a Judge
may make an order for the preservation or interim custodyof
the subject matter of the litigation, notwithstanding that there is
alleged asmatterofdefencearighttoberelievedwhollyorpartiallyfromsuchliability; or may
order that the amount in dispute be brought into court orotherwise secured.˙Application when and how made5.An application for an order under rule
4 may be made by the plaintiffat any time; and
may be made upon the pleadings, if the plaintiff’s rightappears by the pleadings; or, if there are no
pleadings, upon proof of thefacts by
affidavit or otherwise to the satisfaction of the Court or a
Judge.˙Order for sale of perishable goods
etc.6.The Court or a Judge may, on the
application of any party to a cause ormatter, make an
order for the sale, by any person or persons named in suchorder, and in such manner, and on such terms,
as the Court or Judge maythink desirable, of any goods, wares,
or merchandise being the subject ofthe cause or
matter, or as to which any question may arise therein, whichmay
be of a perishable nature or likely to be injured by keeping them,
orwhich for any other just and sufficient
reason it may be desirable to havesold at
once.
301Rules of the Supreme Court˙Applications under s 5(8) of the
Judicature Act, or rule 1 or 67.(1)An
application for an injunction or receiver, or for an order
underrule 1 or 6, may be made to the Court or a
Judge by any party.(2)An application for an injunction or
receiver may be made either exparte or upon
notice.(3)An application for an order under rule
1 or 6 may be made uponnoticetotheoppositepartyatanytimeafterthecommencementofthecause,and,ifthepartymakingtheapplicationisnottheplaintiff,afterappearance by the party.˙Early
trial of cause8.When an application is made before
trial for an injunction or otherorder, and it
appears to the Court or Judge that the matter in controversy
inthe cause can be most conveniently dealt with
by an early trial, without firstgoing into the
whole merits on affidavit or other evidence for the purposesof
the application, the Court or Judge may, subject to the right of
eitherparty to demand a jury, make an order for
such trial accordingly, and maydirect such trial
to be had at any time or place, and in any manner in which acause
may be tried, and in the meantime may make such order as the
justiceof the case may require.˙Order
for recovery of specific property, other than land, subject
tolien etc.9.When
an action is brought to recover, or a defendant in his or
herdefence seeks by way of counterclaim to
recover, specific property otherthan land, and it
appears from the pleadings, or, if there are no pleadings,
itis made to appear, by affidavit or otherwise,
to the satisfaction of the CourtoraJudge,thatthepartyfromwhomsuchrecoveryissoughtdoesnotdispute the title of the party seeking
to recover the same, but claims to retainthe property by
virtue of a lien, or otherwise as security for any sum ofmoney, the Court or a Judge may at any time
order that the party claimingto recover the
property be at liberty to pay into court, to abide the event
ofthe action, the amount of money in respect of
which the lien or security isclaimed, and such
further sum (if any) for interest and costs as the Court
or
302Rules of the Supreme CourtJudge
may direct, and that, upon such payment into court being made,
theproperty claimed shall be given up to the
party claiming it.˙Allowance of income of property
pendente lite10.An application under theEquity Act 1867, section 77 for
the paymentof the income of any real or personal estate
which forms the subject of anycause or matter
may be made to a Judge.˙Injunction against
repetition of wrongful act or breach of contract11.In any action in which an injunction
has been or might have beenclaimed, the
plaintiff may, before or after judgment, apply for an
injunctionto restrain the defendant or respondent from
the repetition or continuance ofthewrongfulactorbreachofcontractcomplainedof,orfromthecommission of any injury or breach of
contract of a like kind relating to thesame property or
right, or arising out of the same contract; and the Court ora
Judge may grant the injunction, either upon or without terms, as
may bejust.˙Damages for injunction wrongly granted12.(1)Everyinterlocutoryorderforaninjunctionshallcontainanundertakingbythepartyatwhoseinstanceitisgrantedtopaytotheoppositepartyanydamageswhichsuchoppositepartymaysustainbyreason of the injunction, and which the Court
or Judge may think the partyought to
pay.(2)An application for an order for
payment of such damages shall bemade by motion,
and the damages may be ordered to be assessed in anymanner in which damages may be assessed in an
action.†2. Receivers˙Receivers—security by and allowance to—form
of security13.(1)When an order is
made directing a receiver to be appointed, theperson to be
appointed shall, unless otherwise ordered, first give security,
to
303Rules of the Supreme CourtbeapprovedbytheCourtorJudgeandtakenbeforetheregistraroracommissionerforaffidavits,dulytoaccountforwhatthepersonshallreceive as such receiver, and to pay the same
as the Court or Judge shalldirect; and the
person so to be appointed shall, unless otherwise ordered,
beallowed a proper salary or allowance.(2)Such security shall be in the form in
schedule 1, unless the Court or aJudge otherwise
orders.˙Where receiver appointed in
court—adjournment into chambers togive
security14.When a judgment or order is pronounced
or made in court by whicha person therein named is appointed to
be receiver, the Court may adjournthe cause or
matter to chambers, in order that the person named as
receivermay give security as in rule 13 mentioned,
and may thereupon direct suchjudgment or order
to be drawn up.˙Fixing days for receivers to leave and
pass their accounts and pay inbalances—neglect
of receivers15.(1)When a receiver
is appointed with a direction that the receiver shallpass
accounts, the Court or Judge shall fix the days upon which the
receivershall, either annually, or at longer or
shorter periods, leave and pass suchaccounts, and
also the days upon which the receiver shall pay the balancesappearingdueontheaccountssoleft,orsuchpartthereofasshallbecertified as proper to be paid by the
receiver.(2)If no days are fixed, the accounts
shall be left half-yearly, and thebalanceshallbepaidmonthly,reckoningineachcasefromthedayonwhich the
receiver is appointed.(3)If any such
receiver neglects to leave and pass the receiver’s accounts,and
pay the balances thereof at the times fixed for that purpose as
aforesaid,the Judge before whom such receiver is to
account may, from time to time,when the
receiver’s subsequent accounts are produced to be examined
andpassed, disallow the salary therein claimed
by such receiver, and may also,iftheJudgethinksfit,chargethereceiverwithinterestataratenotexceeding 8% per annum upon the balances so
neglected to be paid by the
304Rules of the Supreme Courtreceiver for the time during which the same
appear to have remained in thereceiver’s
hands.˙Form of receivers’ accounts16.Receivers’ accounts shall be in the
form in schedule 1, with suchvariations as
circumstances may require.˙Leaving account in
registry17.(1)Areceivershallleavethereceiver’saccountintheregistry,together with an affidavit verifying the same
in the form in schedule 1, withsuch variations
as circumstances may require.(2)An
appointment shall thereupon be obtained by the plaintiff or
otherpersonhavingtheconductofthecauseforthepurposeofpassingsuchaccount.˙Consequences of default by receiver18.If a receiver fails to leave any
account or affidavit, or to pass suchaccount, or to
make any payment, or otherwise to perform the receiver’sduty,
any party may apply to the Court or a Judge for a peremptory
orderrequiring the receiver to do the act which
the receiver has failed to do, andthereupon the
Court or Judge may make such peremptory order, or mayorder
the receiver to be discharged and another appointed, or may
makesuch other order, and may give such
directions as to costs or otherwise, asmay be
just.˙Account on discharge of receiver19.When a receiver is discharged before
the receiver’s final accountshave been passed,
the receiver shall leave his or her account in the registrywithin such time as may be directed by the
order of discharge.˙Death of receiver20.(1)When
a receiver dies, any party to the cause or matter may applyby
summons for an order that the personal representative of the
deceased
305Rules of the Supreme Courtreceiver shall leave at the registry, within
a time to be specified in the order,an account
showing the receipts and payments of the receiver from the
dateof the receiver’s appointment or from the
receiver’s last account, as the casemay be, to the
date of his or her death.(2)Such account
shall be verified, examined, and passed, in the samemanner as other receiver’s accounts.˙Certificate of receiver’s
account21.Theregistrarshallgiveacertificatestatingtheresultoftheexamination of a receiver’s
account.†3. Stop orders˙Order
to prevent transfer or payment without notice to applicant22.Any person claiming to be entitled to
or to have a charge upon anymoneys or
securities standing to the credit of a cause or matter in court
mayapply to a Judge for an order to prevent the
payment or transfer thereof toany person
without notice to the person.˙Mode
of application23.The application for such order shall
be made by summons, whichmust be served upon the persons
interested in such parts of the moneys orsecurities as are
sought to be affected by the order asked for, but need not
beserved upon the parties to the cause or
matter or any other persons, unlessthey are so
interested.˙Costs24.The
costs of and occasioned by any such application or order shall
bein the discretion of the Court or
Judge.
306Rules of the Supreme Court†ORDER 59—INTERPLEADER˙When relief by interpleader
granted1.Relief by way of interpleader may be
granted in the following cases,that is to
say—(a)on the application of any person who
is under liability for anydebt,money,goods,orchattels,fororinrespectofwhichanactionhasbeenbroughtagainsttheperson,andinrespectwhereof some
third party has also sued or is expected to sue;(b)on the application of a sheriff or
other person charged with theexecution of
process by or under the authority of the Court, whenaclaimismadetoanymoney,goods,orchattels,takenorintended to be taken in execution
under any process, or to theproceeds or
value of any such goods or chattels, by any personother than the person against whom the
process issued.˙Procedure2.(1)In
the first case the application for relief shall be made by
summonsin the action, or by 1 summons entitled in
all the actions, as the case maybe.(2)In the second case the application
shall be made by summons in thecause or matter
in which the process is issued.˙Summons3.The
summons shall, in either case, call on the claimants to appear
andstate the nature and particulars of their
claims, and either to maintain orrelinquish
them.˙Matters to be proved by
applicant4.TheapplicantmustsatisfytheJudgeorregistrarbyaffidavitorotherwise—(a)thattheapplicantclaimsnointerestinthesubjectmatterin
307Rules of the Supreme Courtdispute, otherwise than for charges or
costs; and(b)that the applicant does not collude
with any of the claimants; andalso(c)except in the case of a sheriff or
other person charged with theexecution of
process by or under the authority of the Court who,havingseizedgoodshas,sincetheissueofthesummons,withdrawn from
possession upon the admission by the executioncreditoroftheclaimoftheclaimantunderrule16,thattheapplicant is willing to pay or transfer the
subject matter into courtor to dispose of it as the Court or a
Judge or registrar may direct.˙Adverse titles of claimants5.The applicant shall not be disentitled
to relief by reason only that thetitles of the
claimants have not a common origin, but are adverse to andindependent of one another.˙When application to be made by a
defendant6.(1)If the applicant
is a defendant in an action, application for relief maybe
made at any time after service of the writ of summons.(2)Service of the summons upon the
plaintiff or plaintiffs in the actionor actions may be
made at his, her or their address or addresses for servicein
the same manner as if the summons were a proceeding in that action
orin the respective actions.˙Stay of action7.If
the application is made by a defendant in an action, the Judge
orregistrar may stay all further proceedings in
that action or in the respectiveactions.˙Order upon summons8.If
the claimants, or either of them, appear or appears in pursuance
ofthesummons,theJudgemayordereitherthatanyclaimantbemadeadefendant in any action already commenced in
respect of the subject matter
308Rules of the Supreme Courtin
dispute, in lieu of or in addition to the applicant, or that an
issue betweenthe claimants be stated and tried, and in the
latter case may direct which ofthe claimants is
to be plaintiff and which defendant.˙Disposal of matters in summary manner9.The Judge may, with the consent of
both claimants or on the requestofanyclaimant,if,havingregardtothevalueofthesubjectmatterindispute, it seems desirable so to do, dispose
of the merits of their claims,and may decide
the same in a summary manner, either in chambers or incourt, and on such terms as may be
just.˙Questions of law10.(1)If
the question in dispute is a question of law, and the facts are
notin dispute, the Judge may either decide the
question without directing thetrial of an
issue, or may order that a special case be stated for the opinion
ofthe Court.(2)If a
special case is ordered to be stated, the provisions of order
38shall, as far as applicable, apply
thereto.˙Failure of claimant to appear, or
neglect to obey summons11.If a claimant,
having been duly served with the summons, does notappearinpursuanceofthesummons,or,havingappeared,neglectsorrefusestocomplywithanyordermadeafterhisorherappearance,theJudge
may make an order declaring the claimant, and all persons
claimingundertheclaimant,foreverbarredagainsttheapplicantandpersonsclaiming under
the applicant; but any such order shall not affect the rights
ofthe claimants as between themselves.˙Order for sale of goods seized in
execution12.When goods or chattels have been
seized in execution by a sheriff orother officer
charged with the execution of process of the Court, and anyclaimantallegesthattheclaimantisentitled,underabillofsaleorotherwise, to the goods or chattels by way of
security for debt, the Judgemayorderthesaleofthewholeorapartthereof,andmaydirectthe
309Rules of the Supreme Courtapplication of the proceeds of the sale in
such manner and upon such termsas may be
just.˙Application of orders 35, 36, and 39 to
interpleader proceedings13.Orders 35, 36,
and 39, shall, with the necessary modifications, applyto
interpleader issues; and the Court or Judge by or before whom the
issueistriedmayfinallydisposeofthewholematteroftheinterpleaderproceedings,
including all costs not otherwise provided for.˙Title
of order14.When in any interpleader proceeding it
is necessary or expedient tomake 1 order in
several causes or matters pending before different Judges,suchordermaybemadebytheJudgebeforewhomtheinterpleaderproceeding is
taken, and shall be entitled in all such causes or matters;
andany such order shall, subject to the right of
appeal, be binding on the partiesin all such
causes or matters.˙Costs etc.15.The
Court or a Judge may, in or for the purposes of any
interpleaderproceedings, make all such orders as to costs
and all other matters as maybe just and
reasonable.˙Claim, how made—notice
thereon—sheriff’s costs16.(1)Uponanyclaimbeingmadetoorinrespectofanygoodsorchattels taken in execution under the
process of the Court the sheriff or otherofficer charged
with the execution of the process shall forthwith give
noticethereof to the execution creditor in the form
in schedule 1, or to the likeeffect, and the
execution creditor shall, within 4 days after receiving thenotice, give notice in the form in schedule
1, or to the like effect, to thesheriff or such
other officer, stating whether he or she admits or disputesthe
claim.(2)If the execution creditor admits the
title of the claimant, and givesnotice as
directed by this rule, the execution creditor shall only be liable
to
310Rules of the Supreme Courtsuch
sheriff or officer for any fees and expenses incurred prior to the
receiptof the notice admitting the claim.˙Withdrawal of sheriff17.(1)If the execution
creditor gives notice to the sheriff or such otherofficerthattheexecutioncreditoradmitstheclaimoftheclaimant,thesheriff or officer shall forthwith withdraw
from possession of the goodsclaimed.(2)Butiftheexecutioncreditordoesnotinduetime,asdirectedbyrule
16, admit or dispute the title of the claimant to the goods or
chattels,and the claimant does not withdraw his or her
claim thereto by notice inwritingtothesherifforsuchotherofficer,thesheriffmaytakeoutaninterpleader summons.˙Costs18.If
at or before the hearing of the summons the execution
creditoradmits the title of the claimant, or the
claimant withdraws his or her claim,the Judge may
nevertheless make as against the execution creditor, or asagainst the claimant if he or she appears,
any such order as to costs, fees,charges, and
expenses, as may be just and reasonable.˙Payment into court19.If
the Court or Judge directs that the claimant shall pay money
intocourtasaconditionofthesherifforotherofficerwithdrawingfrompossession of the goods or chattels claimed,
and the claimant pays moneyinto court
accordingly, the money so paid into court shall be deemed torepresent the goods or chattels claimed in
whole or in part, as the case maybe, so that the
claimant shall not, so long as the money remains in court,
beliable to make any further payment into court
or otherwise as a condition ofwithdrawal from
seizure under any other execution against the same goodsor
chattels, except so far as the value of the goods or chattels may
exceedthe amount so paid in.
311Rules of the Supreme Court†ORDER 60—STAYING PROCEEDINGS˙General authority to stay1.The authority of the Court or a Judge
to direct a stay of proceedings ina cause or matter
may be exercised at any time after the institution of thecauseormatter,andmaybeexercised,eitherastothewholecauseormatter, or as to any proceedings
therein, or as to any proceedings under ajudgment or order
given or made therein.˙Stay of
proceedings on ground of abuse of procedure2.Anapplicationtostayproceedingsonthegroundthatthereisnoreasonable or probable cause of action
or suit, or that the action or suit orproceeding is
vexatious and oppressive, or is an abuse of the procedure ofthe
Court, may be made at any time, and whether the plaintiff does or
doesnot admit the allegations of fact (if any) on
which the application is founded.˙Stay
of proceedings3.The Court or a Judge may stay the
proceedings in any cause or matterimproperly
instituted in the name of any person by a next friend.˙Withdrawing juror4.WhenatthetrialofacausebeforeaJudgewithajuryajuroriswithdrawn with the consent of the parties,
such withdrawal shall have theeffect of an
order by consent for the staying of all proceedings in the
causeor matter, except so far as the Court at the
time of the withdrawal, and withthe consent of
the parties, otherwise orders.˙Staying action until costs paid5.When an action is discontinued or
dismissed for want of prosecution,orjudgmentofnonsuitisentered,if,beforepaymentofthecosts,asubsequent action is brought for the
same, or substantially the same, causeofaction,theCourtoraJudgemayorderthatproceedingsinsuchsubsequent action
shall be stayed until such costs have been paid.
312Rules of the Supreme Court†ORDER 61—TRANSFERS AND
CONSOLIDATION˙Transfer from one Judge to another on
fiat of Judges1.Any cause or matter may, at any stage,
be transferred from one Judgeto another by an
order to be drawn up on the fiat of such 2 Judges, or byrule
of court.˙Transfer of action where order for
winding-up or administrationmade3.When an order has been made by any
Judge for the winding-up of anycompany, or for
the administration of the assets of any testator or
intestate,or for any relief incident to such
administration, or for the administration ofany trust, the
Judge in whose court such winding-up or administration shallbependingshallhavepower,withoutanyfurtherconsent,toorderthetransfer to himself or herself of any cause
or matter pending in any othercourtandbroughtorcontinuedbyoragainstsuchcompany,orbyoragainst the
executors or administrators of the testator or intestate
whoseassets are being administered, or against the
trustees of the trust which isbeing
administered, as the case may be.˙Consolidation of causes or matters5.(1)Causes or
matters may be consolidated by order of the Court or aJudge, in any case in which it appears that
substantially the same question isinvolved in all
the causes or matters, or that the decision in 1 cause or
matterwilldeterminetheotherorothersorthatforsomeotherreasonitisdesirable to make an order under this
rule.(2)The application may be made by any
person who is a party to 2 ormore of the
causes or matters.†Transfer of proceedings from one
branch of the Court to another˙In
case of absence etc. of central, northern or far northern
judge6.(1)Whenever—
313Rules of the Supreme Court(a)byreasonofillness,interest,orotherinability,thecentral,northern or far
northern judge is unable to hear or determine anymotion or application intended to be made in
any cause or matterdepending in the Supreme Court at
Rockhampton, Townsville orCairns, respectively; or(b)any party desires to make a motion or
application in any suchcause or matter, but is unable to do
so by reason of the absence ofthecentraljudgefromRockhampton,northernjudgefromTownsville, or far northern judge from
Cairns, and such absenceis likely to last for a period longer
than 7 days;andnootherJudgeispresentatRockhampton,TownsvilleorCairnsrespectively, the
party desiring to make the application may lodge with theregistraroftheSupremeCourtatRockhampton,TownsvilleorCairnsrespectively a
request, in the form in schedule 1, that the cause or mattermay
be transferred, for the purpose of the application only, to the
SupremeCourt at Brisbane; and the cause or matter
shall thereupon, without furtherorder, be
transferred accordingly.(2)The registrar at
Rockhampton, Townsville or Cairns shall thereupontransmit the request to the registrar at
Brisbane, together with such papersanddocumentsasarenecessaryforthepurposeofthemotionorapplication.(3)The
motion or application may be heard and disposed of at
Brisbaneby any Judge of the Court; and, as soon as it
has been disposed of, thecauseormattershall,withoutfurtherorder,bere-transferredtotheSupreme Court at Rockhampton,
Townsville or Cairns, as the case may be,andallpapersanddocumentsrelatingtoitshallbetransmittedbytheregistrar at Brisbane to the registrar
of that Court.(4)No fees shall be payable in respect of
any such transfer or re-transfer.˙Notice, how given7.In
any of the cases mentioned in rule 6, if the application is to be
madeupon notice to any person, the notice may be
given of the motion to bemade before a Judge at Brisbane, or the
summons may be made returnablebeforeaJudgeatBrisbaneonadaytobefixedbytheregistraratRockhampton, Townsville or
Cairns.
314Rules of the Supreme Court˙Order to be communicated in
writing8.WheninanysuchcaseanorderhasbeenmadebyaJudgeatBrisbane, the registrar shall, at the
request and expense of either party, andwithoutpaymentofanyfurtherfee,givetheregistraratRockhampton,TownsvilleorCairnswrittennoticeoftheeffectoftheorder;andtheregistrarorotherofficeratRockhampton,TownsvilleorCairnsmaythereupon, and without waiting for receipt of
the order, do any such act asthe registrar or
other officer is authorised by the order to do.˙Transfers in other cases9.(1)Except as hereinbefore provided, the
transfer of any cause or matterdependingintheSupremeCourtatBrisbanetotheSupremeCourtatRockhampton, Townsville or Cairns, and
of any cause or matter dependingin either of
those Courts to the other, or to the Supreme Court at
Brisbane,shall be made by order of the Court or a
Judge, or by consent order.(2)If the cause or
matter is depending in the Supreme Court at Brisbane,anapplicationfortransfermustbemadetotheCourtoraJudgeatBrisbane.(3)IfthecauseormatterisdependingintheSupremeCourtatRockhampton, it must be made to the
Central Judge.(4)IfthecauseormatterisdependingintheSupremeCourtatTownsville, it must be made to the
Northern Judge.(5)If the cause or matter is depending in
the Supreme Court at Cairns,the application
for transfer must be made to the far northern judge.(6)The transfer may be ordered on such
terms as the Court or Judgethinks
fit.†ORDER 62—MOTIONS˙Application by motion1.When
by these rules any application is authorised to be made to
the
315Rules of the Supreme CourtCourt
or a Judge, such application, if made to the Court of Appeal or to
aJudge in court, and not required to be made
by petition, shall be made bymotion.˙Title of notices of motions2.(1)When a motion is
made upon notice in a cause or matter, the noticeshall
be entitled in the cause or matter.(2)When
a cause or matter is originated by notice of motion, the
noticeshall be entitled in the matter of the
statute under which the motion is to bemade,andinthematteroftheapplicationoftheapplicant,namingtheapplicant, for the relief sought,
describing briefly the nature of such relief.˙Originating notices3.(1)When
a cause or matter is originated by a notice of motion, a
copyof the notice shall be filed before the
motion is heard.(2)In other cases a copy need not be
filed.˙Notice of motion to name Judge4.A notice of motion shall name the
Court or Judge before whom, andthe time at
which, it is intended to be made, and shall be signed with
thename of the party intending to move, or the
party’s solicitor, if the partysues or appears
by a solicitor, and addressed to the party to be affected bythe
order sought.˙To be moved by counsel in order of
seniority5.On days on which the Court of Appeal
sits to hear motions they shall,unless the Court
otherwise orders, be heard before the matters set down inthe
paper are called on for hearing, and counsel may move them in the
orderof their seniority.˙Costs
of abandoned motions6.(1)If a motion of
which notice has been given is not moved at the
316Rules of the Supreme Courtsitting of the Court for which notice was
given, or at any adjournment ofthatsitting,thepartytowhomthenoticewasgivenmay,onfilinganaffidavit stating the fact, obtain an order
for the payment to the party by theparty by whom the
notice was given of his or her costs of the motion; andsuchordermaybedrawnupandsignedbytheregistrarwithoutotherwarrant than this
rule.(2)But any such order may be set aside by
the Court or a Judge uponsufficient cause shown.˙Restrictions on rules nisi and orders
to show cause7.(1)A rule nisi or
order to show cause shall not be made in an action, oronanapplicationtosetaside,remit,orenforceanaward,oronanapplication for
an attachment, or for an order to answer the matters in anaffidavit, or on an application against the
sheriff to pay money levied underan
execution.(2)But upon any motion or application for
a rule or order ex parte in thefirst instance
the Court or Judge may grant a rule or order calling on theparty
to be affected by the order to show cause why it should not be
made.˙Where notice of motion to be given—ex
parte applications8.(1)Exceptasbytheserulesotherwiseprovided,amotionorapplication shall not be made without
previous notice to the party to beaffected
thereby.(2)But the Court or a Judge, if satisfied
that the delay caused by givingnotice would or
might entail irreparable or serious mischief, may make anyorder
ex parte upon such terms as to costs or otherwise, and subject to
suchundertaking (if any) as the Court or Judge
may think just; and any partyaffected by any
such order may move to set it aside.˙Grounds of notice of motion to be stated in
certain cases—copies ofaffidavits9.Every notice of motion to set aside, remit,
or enforce an award, or foran attachment,
shall state in general terms the grounds of the application;and,
when any such motion is founded on evidence by affidavit, a copy
of
317Rules of the Supreme Courtevery
affidavit intended to be used on the motion shall be served with
thenotice of motion.˙Length
of notice of motion10.Unless the Court or a Judge gives
special leave to the contrary, whichleave may be
obtained ex parte, there must be at least 2 clear days
betweenthe service of a notice of motion and the day
named in the notice for makingthe
motion.˙Motions may be dismissed or adjourned
where necessary notice notgiven11.If,
on the hearing of a motion or other application, the Court or
aJudgeisofopinionthatanypersontowhomnoticehasnotbeengivenoughttohavenotice,theCourtmayeitherdismissthemotionorapplication, or may adjourn the hearing
thereof, in order that such noticemay be given,
upon such terms (if any) as the Court or Judge may think
fit.˙Adjournment of hearing12.The hearing of any motion or
application may from time to time beadjourned upon
such terms (if any) as the Court or Judge may think fit, andthe
Court or Judge may order that any question of fact arising on the
motionor application be tried in any manner in
which any question or issue of factin an action may
be tried.˙Service of notice of motion with
originating proceedings13.A plaintiff may,
without any special leave, serve any notice of motionupon
any defendant along with the originating proceeding, or at any
timeafterserviceoftheoriginatingproceeding,andbeforethetime(ifany)limited for the
appearance of such defendant.˙Service of notice on defendant served but not
appearing14.A plaintiff may, without any special
leave, serve any notice of motionorothernoticeoranypetitionorsummonsuponanydefendant,who,
318Rules of the Supreme Courthaving been duly served with the originating
proceeding and required toappear, has not appeared within the
time limited for that purpose.˙Notice
of evidence15.(1)Alistofallaffidavitsintendedtobeusedonthehearingofamotion shall be
served with the notice of motion; and no other affidavitsshall
be used, or other evidence given, on the hearing without the leave
ofthe Court.(2)Whenitisintendedtoadduceoralevidenceonthehearingofamotion, notice of such intention shall
be served with the notice of motion.˙In
admiralty actions16.In admiralty actions, a copy of every
affidavit intended to be used onthe motion shall
be served with the notice of motion.†ORDER 63—PETITIONS˙Title
and address1.(1)Petitions in a
cause or matter shall be entitled in the cause or matter.(2)Petitionsbywhichacauseormatterisoriginatedshall,unlessotherwise
directed by these rules, be entitled in the matter of the estate
ortrust or other subject matter in respect
whereof they are presented, in such amanner as to
identify it, and, if they are presented under the provisions of
astatute, shall also be entitled in the matter
of the statute by its short title.(3)Allpetitionsshallbeaddressedto‘theSupremeCourtofQueensland’.˙Form
of petitions2.(1)Every petition
shall contain a statement, as brief as the nature of thecase
will allow, of the material facts on which the petitioner relies,
but not
319Rules of the Supreme Courtthe
evidence by which they are to be proved, nor, except so far as they
arematerial, the contents of documents.(2)Thepetitionshall,whennecessary,bedividedintoparagraphs,numberedconsecutively,andeachcontaining,asnearlyasmaybe,aseparate allegation.(3)Dates, sums, and numbers may be expressed in
figures or in words.(4)Signature of counsel shall not be
necessary, but the petition shall besigned by the
solicitor of the party, or by the party personally, if the
partyproceeds in person.˙Statement of persons to be served with
petition3.At the foot of every petition, and of
every copy thereof, a statementshall be made of
the persons (if any) intended to be served therewith, and,
ifno person is intended to be served, a
statement to that effect shall be made atthe foot of the
petition.˙Filing4.Every petition shall be filed.˙Time for hearing5.(1)In
the case of a petition in a cause or matter which is to be
servedon a party to the cause or matter, there must
be at least 2 clear days betweenthe day of
service and the day for which the petition is set down to be
heard,unless the Court or a Judge gives leave to
bring on the petition on shorternotice.(2)In any other case the same time must
be allowed between the day ofservice and the
day appointed for the hearing of the petition as would beallowed for appearance to a writ of summons
directed to the same person,unless the Court
or a Judge otherwise orders.˙Appointment of hearing6.(1)Upon
the filing of an originating petition the proper officer
shallappointadayforthehearingthereof,andshallendorsethereona
320Rules of the Supreme Courtmemorandum requiring all parties concerned to
attend the Court at the timeso
appointed.(2)A copy of such endorsement shall be
endorsed upon every copy ofthe petition
intended for service, and shall be sealed with the office
seal.˙Service7.(1)The
service of an originating petition shall be effected by
servingthe party with a copy of the petition,
endorsed as aforesaid, in the samemanner in which a
writ of summons in an action is required to be served,except that the original petition and
memorandum need not be produced.(2)The
service of a petition in a cause or matter on any party to the
causeor matter shall be effected by leaving a copy
for the party to be served at theparty’s address
for service, if the party has an address for service.(3)If the party has no address for
service, it must be served upon theparty personally,
unless the Court or a Judge otherwise directs.(4)The
copy must be endorsed with a notice stating the time for
whichthe petition is set down to be heard.˙Evidence8.(1)Petitions must be verified by affidavit, or
in such other manner asthe Court may allow.(2)The Court may allow a petition to be
verified by reference to thepetition itself,
without repetition of the facts set out therein, if the facts
aresuch that the deponent can sufficiently
verify them in that manner.†ORDER 64—ORIGINATING SUMMONSES˙Jurisdiction1.Thefollowingmattersmaybeheardanddisposedofinchambersupon originating
summons, that is to say—
321Rules of the Supreme Court(a)applications for interim or permanent
investment of, and for thepayment of interest arising from,
moneys paid into court undertheRailway Act 1864or thePublic Works Lands Resumption Act1878,oranyotherActbywhichthepurchasemoneyoflandtaken or sold,
or compensation for injury to land, is directed to bepaid
into court;(b)applications, not being applications
made in a pending cause ormatter, for the appointment of a
guardian of an infant, or for thecustody,maintenance,oradvancementofinfants,oraccesstoinfants, or the administration of their
estate;(c)applications, not being applications
made in a pending cause ormatter,forthesanctionoftheCourttothesettlementofanypropertyofaninfantonmarriageundertheprovisionsoftheEquity Act 1867, section
151;(d)applications, not being applications
made in a pending cause ormatter, under the provisions of
theTrusteesandof
theTrusteesand
Incapacitated Persons Act 1867;(e)applications under theSettled Land Act 1886;(f)applications, not being applications
made in a pending cause ormatter, under the provisions of
theTrusteesandExecutorsAct1897,whicharenotbytheserulesdirectedtobemadebypetition;(g)applications for orders for the delivery or
taxation of a solicitor’sbillofcosts,orforthedeliveringupbyasolicitorofdeeds,documents, or
papers in his or her custody, possession, or power,or
otherwise relating to the same;(h)applications, not being applications made in
a pending action, forreliefagainstaforfeitureforbreachofaconditiontoinsureagainst loss or
damage by fire;(i)applications, not being applications
made in a pending cause ormatter,relatingtothesaleormanagementofproperty,orthedisposition of the proceeds of
sale;(j)any application authorised by any
statute, or by these rules to bemade by
originating summons;(k)any application,
not being an application made in a pending cause
322Rules of the Supreme Courtor
matter, for any order authorised by any statute or by these
rulesto be made by a Judge, and not expressly
required to be made bya Judge in court, or upon
petition.˙Power to make declaration on
summons1A.Any person claiming to be interested
under a deed, will, contract, orotherwritteninstrument,mayapplybyoriginatingsummonsforthedetermination of
any question of construction arising under the instrument,and
for a declaration of the rights of the persons interested.˙Construction of statute1B.Any person claiming any legal or
equitable right in a case where thedeterminationofthequestionwhetherthepersonisentitledtotherightdependsuponaquestionofconstructionofastatute,mayapplybyoriginatingsummonsforthedeterminationofsuchquestionofconstruction, and for a declaration as
to the right claimed.˙Questions of
law1BB.Any person
claiming any legal or equitable right in a case wherethe
determination of the question whether the person is entitled to the
rightdepends upon a question of law, and there is
unlikely to be any substantialdispute of fact,
may apply by originating summons for the determination ofsuch
question of law, and for a declaration as to the right
claimed.˙Service1C.The
Court or a Judge may direct such persons to be served with
thesummons as the Court or Judge may think
fit.˙Evidence1D.The
application shall be supported by such evidence as the Court or
aJudge may require.
323Rules of the Supreme Court˙Discretion of Court1E.A
question of construction under rule 1A or 1B or a question of
lawunder rule 1BB shall be determined having
regard to the events that havehappened but the
Court or a Judge shall not be bound to determine any suchquestion if there is any substantial dispute
of fact or if for any other reasonintheir,hisorheropinionitoughtnottobedeterminedonoriginatingsummons.˙Form of summons2.(1)An
originating summons shall be in the form in schedule 1 withsuch
variations as circumstances may require.(2)It
shall be prepared by the plaintiff or other applicant or his or
hersolicitor, and shall be issued in the same
manner as prescribed in the issueof a writ of
summons, and a copy thereof shall be filed in the registry, as
inthat case.(3)At
the foot of the summons, and of every copy thereof, a
statementshall be made of the persons (if any)
intended to be served therewith, and, ifno person is
intended to be served, a statement to that effect shall be made
atthe foot of the summons.˙Endorsement of address3.The
summons shall be endorsed with the address of the applicant,
andthenameandaddressoftheapplicant’ssolicitor(ifany)inthesamemanner as
required in the case of a writ of summons.˙Time
for service4.An originating summons which is to be
served upon any person shallbe served 2 clear
days before the summons is returnable, unless a longernotice is required by these rules, or unless
a Judge otherwise orders.˙No appearance
required5.An appearance need not be entered to
an originating summons.
324Rules of the Supreme Court˙Ex parte applications6.An originating summons to be heard ex
parte may be made returnableon any chamber
day of the Judge to whom the matter is assigned.†Solicitors˙Account by solicitor7.(1)When
the relationship of solicitor and client exists, or has
existed,anoriginatingsummonsmaybeissuedbytheclientortheclient’srepresentatives for the delivery of a cash
account, or the payment of money,or the delivery
of securities, by the solicitor; and the Judge may from timetotimeorderthesolicitortodelivertotheapplicantparticularsofthemoneys or securities which the
solicitor has in his or her custody or controlon behalf of the
applicant, or to bring into court the whole or any part of
thesame, within such time as the Judge may
order.(2)If the solicitor sets up a claim for
costs, the Judge may make suchprovisionforthepaymentthereof,orforsecuringthesame,orfortheprotection of the
respondent’s lien (if any) as the Judge may think fit.†ORDER 65—CHAMBERS†1.
Jurisdiction in chambers˙General
jurisdiction1.The following matters may be
determined by a Judge in chambers,that is to
say—(a)any application authorised by statute
or by these rules to be madeto a Judge, and
not specifically required to be made to a Judge incourt;(b)any
application relating to the conduct of a cause or
matter;
325Rules of the Supreme Court(c)anyapplicationinapendingcauseormatterwhich,iftheapplication were
not made in a pending cause or matter, might,under the
provisions of these rules, be heard and determined by aJudge in chambers;(d)applications for payment or transfer to any
person of any moneyor securities standing to the credit of any
cause or matter wheretherehasbeenajudgmentororderdeclaringtherightsoftheapplicant, or where the title of the
applicant depends only uponproofoftheidentity,orofthebirth,marriage,ordeath,ofparticular persons;(e)applications for payment or transfer to any
person of any moneyor securities standing to the credit of a
cause or matter, when thenominal amount or value of either the
money or the securitiesproposedtobedealtwithdoesnotexceed£1000($2000),exclusive of interest;(f)applicationsforpaymenttoanypersonoftheinterestordividends on any money or securities
standing to the credit of acause or matter,
whether to a separate account or otherwise;(g)applications relating to the investment or
disposition of money orsecurities in court;(h)applications for orders on the further
consideration of any causeor matter, when the order to be made
is for the distribution of aninsolvent estate
or for the distribution of the estate of an intestate,orforthedistributionofafundamongcreditorsordebentureholders;(i)applicationsinacauseormatterfororrelatingtothesaleofproperty by auction or private contract, and
as to the manner inwhich the sale is to be conducted, and for
payment into court andinvestment of the
purchase-money;(j)applications for directions as to the
management of any propertyunder the control of the Court;(k)applications for orders or directions
as to any matter which bythese rules is made subject to the
order or direction of a Judge.
326Rules of the Supreme Court˙Powers of registrar1A.(1)A
registrar at Brisbane, Rockhampton, Townsville or Cairns maytransact all such business and exercise all
such authorities and jurisdiction inrespect of the
same as under any Act of the State or rule of court
thereundermay be transacted or exercised by a Judge in
chambers in respect of thefollowing proceedings and matters when
the same are unopposed—(a)passingaccountsandallowingcommissioninprobateandadministration matters;(b)extending time for renewal of registration
of bills of sale;(c)extending time for registration of
stock mortgages, liens on wooland liens on
crops including crops of sugarcane and renewal ofregistration of liens on such crops;(d)extending time for registration of
charges under section 106 of theCompanies Act
1961;(e)orders to
administer or sell by the Public Trustee and revocationof
elections;(f)to file any document or take any
document off the file or admitinformal
affidavits to be filed.(2)However, the
registrar may refer any of the above applications to aJudge
in chambers and any party may appeal from the order or decision
ofthe registrar to a Judge in chambers.†Procedure in general˙Applications to be made by summons
unless ex parte2.(1)Every
application made to a Judge in chambers in a pending causeor
matter, and not made ex parte, shall be made by summons, signed by
aJudge or the registrar or other proper
officer, and sealed with the office seal.(2)The
summons must be served on the opposite party.
327Rules of the Supreme Court˙Certain ex parte applications to be by
summons3.Every application for payment or
transfer of money or securities outof court made ex
parte shall be made by summons.˙Ex
parte applications in general4.(1)Otherexparteapplicationsinapendingcauseormatter,andapplications for orders nisi, may be made
without summons.(2)But the Judge may, upon any
application made ex parte, require asummons to be
taken out, or a memorandum of the order asked for to befiled.˙Form
of summons5.A summons in a pending cause or matter
shall be entitled in the causeor matter, and
shall be in the form in schedule 1, with such variations ascircumstances may require, and shall be
addressed to all the persons onwhom it is to be
served.˙Alteration of summons6.Summonses shall not be altered after
they are sealed without an orderof a
Judge.˙Service of summons7.(1)Every summons not being an originating
summons shall be served1 clear day before the return day
thereof, unless the Court or a Judge allowsa shorter period
of service.(2)However,asummonsfortimeonlymaybeservedonthedayprevious to the return thereof, and that a
summons signed by a Judge maybe made
returnable at any time.˙No stay unless so
ordered by a Judge8.A summons shall not operate as a stay
of proceedings unless a stay isincluded therein
by order of a Judge.
328Rules of the Supreme Court˙Counsel10.AnypartytoaproceedingbeforeaJudgeinchambersmayberepresented by counsel or by his or her
solicitor.˙Right of audience in chambers11.(1)Subjecttosubrule(2),thefollowingpersonsmaybeheardonapplications in chambers—(a)a solicitor’s managing clerk;(b)a person who has successfully
completed, or has been awardedcredit for half
of the course for, the degree of Bachelor of Laws ofan
Australian university;(c)apersonwhohascompletedorhasbeengrantedexemptionfrom—(i)any 6 subjects of the Solicitors’
Board examinations; or(ii)stage 3 of the
Barristers’ Board examinations;(d)a
person approved by the registrar under subrule (3).(2)A person mentioned in subrule (1)(a)
to (c) may be heard only if theperson has given
to the registrar a certificate from the person’s master, or
apartner in the firm of solicitors in which
the person is employed, stating thatthe
person—(a)is a person mentioned in subrule
(1)(a), (b) or (c); and(b)has a competent
knowledge of the practice of the Court.(3)The
registrar may approve a person as a person who may be heard
onapplications in chambers if the
registrar—(a)is given a certificate from the
person’s master, or a partner in thefirm of
solicitors in which the person is employed—(i)statingthatthepersonhasacompetentknowledgeofthepractice of the
Court; and(ii)giving details
of the person’s legal training and experience;and(b)is satisfied that the person has
sufficient knowledge, training and
329Rules of the Supreme Courtexperience to be heard.(4)The
registrar must keep a list of the persons mentioned in subrule
(1)in the registry.(5)In
the hearing of an application in chambers, a person who—(a)is not a person mentioned in subrule
(1); and(b)is not a party to the application, or
counsel or solicitor for a partyto the
application;may be heard only by leave of a Judge.˙Proceedings when any party fails to
attend12.(1)When any party
to a summons fails to attend within half an hourafter
the time when the application is to be heard, whether upon the
return ofthesummons,oratanytimeappointedfortheconsiderationorfurtherconsideration of
the matter, the Judge may proceed in the party’s absence,if,
considering the nature of the case, the Judge thinks it expedient
so to do.(2)An affidavit of non-attendance shall
not be required or allowed, butthe Judge may
require such evidence of service as the Judge may think fit.˙Reconsideration of
proceeding—costs13.WhentheJudgehasproceededintheabsenceofaparty,theproceedingshallnotbereconsideredinchambers,unlesstheJudgesodirects; and in such case the costs
occasioned by the non-attendance of theparty shall be in
the discretion of the Judge, who may direct them to be paidbythepartybeforethepartyispermittedtohavesuchproceedingreconsidered, or
may make such other order as to such costs as the Judgemay
think just.˙Costs thrown away by non-attendance of
any party14.When a proceeding in chambers fails by
reason of the non-attendanceof any party, and
the Judge does not think it expedient to proceed in theparty’s absence, the Judge may order such an
amount of costs (if any) asthe Judge thinks
reasonable to be paid to the party attending by the absentparty.
330Rules of the Supreme Court˙What matters to be included in the same
summons15.In any cause or matter, any party
making an application at chambersmayincludeinoneandthesamesummonsallmattersuponwhichtheparty
then desires the order or directions of the Judge; and upon the
hearingon the summons the Judge may make any such
order, and give any suchdirections, relative to or
consequential on the matter of the application asmay
be just.˙Adjournment to court or chambers16.(1)Any application
may, if the Judge thinks fit, be adjourned fromchambers into
court.(2)Anyapplicationmadeincourtwhichmighthavebeenmadeatchambers may be adjourned from court
into chambers.˙Further attendance where summons not
fully disposed of17.When all the matters in respect of
which a summons has been issuedare not disposed
of upon the return of the summons, the parties shall attendfrom
time to time, on 1 days notice, without further summons, at such
timeor times as may be appointed for the
consideration or further considerationof the
matter.˙Form of order—signature18.An order made by a Judge shall be in
the form in schedule 1, withsuch variations
as circumstances require, and shall be signed by, or with
thestamp of, the Judge by whom it is made,
unless the Judge directs it to besigned by the
registrar, and shall be sealed with the office seal.˙Signatures of certain orders made in
chambers19.OrdersmadeinchamberstobeactedonbytheTreasurershall,unless the Judge
otherwise directs, be signed by the registrar.
331Rules of the Supreme Court˙Associate’s name to be written on
documents stamped with Judge’sname20.The Judge’s associate by whom the
Judge’s name is impressed on adocument shall
sign the document in his or her own proper handwriting.˙Associate’s duty as to proceedings at
chambers21.TheassociateorJudge’sclerkshallkeepabook,inwhichtheassociate or Judge’s clerk shall enter
particulars of all proceedings had inchambers, with
dates, names of cases, a description of the proceedings, anda
minute of the decisions, and shall deliver all documents used at
chambersto the registrar, who shall initial the
entries.†ORDER 65A—LISTING APPLICATIONS
FORHEARING˙Application1.Thisorderappliestoallmatterslistedforhearinginchambers,whether before a
Judge or by a Master.˙List of
applications2.On the filing of an application for a
determination (whether final orinterlocutory) by
a Judge or by a Master, the registrar must—(a)enter it on a list of applications for
hearing before a Judge or by aMaster according
to the date for hearing; and(b)record on that list the estimated hearing
time for the matter.˙Estimate of
hearing time3.The party filing the application must
endorse on it an estimate of thehearing time for
the matter.
332Rules of the Supreme Court˙Adjournments4.(1)If
an application to which this order applies is adjourned to a
fixeddate, the registrar, on a request for
relisting, must enter it on the appropriatelist for the
adjourned date.(2)Ifanapplicationisadjournedtoadatetobefixed,apartymayrequest that it be relisted for a particular
day.(3)The party who requests the relisting
of an adjourned application mustgive the
registrar a revised estimate of the duration of the hearing unless
therevisedestimatewasgivenorallytotheJudgeorMasterontheadjournment being granted.(4)Whenanapplicationisrelisted,theregistrarmustrecordtheestimated hearing time for the matter on the
list.(5)The party who requests the relisting
of an adjourned application mustgive all other
parties reasonable notice of the new date of hearing.(6)Ifallpartiesconsenttoanadjournment,theymaysignanendorsementtothateffectonthecourtfileandtheapplicationstandsadjourned as if there was an order to that
effect.˙Sequence of listing5.(1)Theregistrarmustenteranapplicationontheappropriatelistimmediately on the filing of the application
or on the request for a relistingbecause of an
adjournment.(2)The sequence of listing must not be
altered except by an order of theCourt.˙Sequence of hearing6.UnlesstheCourtdirectstothecontraryatthedailycall-overorotherwise, applications must be heard in the
sequence in which they appearon the list as
published for that day by the registrar.
333Rules of the Supreme Court†ORDER 66—ORDERS˙Enlarging orders1.(1)When
an order to show cause has been made, and has not beenserved, or has not been served a sufficient
time before the day appointed inthe order for
showing cause the Court or Judge may direct that the ordershall
be amended by appointing a later day for showing cause.(2)Such direction may be given on an ex
parte application either beforeor on the day
appointed for showing cause.˙Orders
of course abolished2.No side-bar rule or order of course
shall hereafter be drawn up.˙Submission to arbitration3.An
order to make a submission to arbitration a rule of court may
bemade by a Judge ex parte.˙Date
of order when drawn up4.Every order,
when drawn up, shall be dated of the day of the week,month, and year, on which the same was made,
unless the Court or Judgeotherwise directs, and shall take
effect accordingly.˙When orders need not be drawn up5.(1)Subject to this
rule and order 88, rule 18, it shall not be necessary todraw
up or enter any order that is interlocutory only, except
where—(a)the Court or a Judge, Master, or
registrar so directs; or(b)it is
sought—(i)to enforce the order by execution or
other process or order ofthe Court; or(ii)to
appeal to the Court of Appeal against the order; or
334Rules of the Supreme Court(c)the order is returnable before the
Court of Appeal.(2)The endorsement or authentication by
the Court, Judge, Master orregistrar who
made the order, or by the associate or clerk to such Judge
orMaster,ofthefileoranydocumentplacedinthefileshall,untilaninterlocutory order is drawn up or
entered, be sufficient proof of the makingof the order, its
date and terms to the extent that the same appears from suchfile
or document.(3)For the purpose of this rule, an
order—(a)does not cease to be interlocutory by
reason only that it orderspayment of or otherwise deals with
costs;(b)is not interlocutory if it finally
disposes of the rights of parties.(4)In
any case of doubt the Court or a Judge, Master, or registrar
maydirect that it shall not be necessary to draw
up or enter an order under theserules.˙Orders for jury6.An
order or precept under theJury Act 1929, section 22 may
be drawnup and signed by the registrar or associate
without other warrant than thisrule.˙Consent orders7.(1)Uponthewrittenconsentofthepartiesortheirsolicitors,theregistrar may draw up, sign, and seal an
order in any case in which, in theregistrar’s
opinion, the Court or a Judge would have made such an orderupon
consent of parties.(2)Every such order shall state that it
is made by consent, and shall be ofthe same force
and validity as if it had been made by the Court or a Judge.(3)Every such consent shall be
filed.(4)The order may include an order as to
costs provided the consent ofthe parties
extends to the order as to costs.
335Rules of the Supreme Court˙Orders drawn up by registrar9.Orders which under the authority of
these rules may be drawn up bythe registrar on
the application of a party without the special direction of
theCourt or a Judge shall be drawn up upon a
praecipe, which shall be filed inthe registry by
the party applying for the order.†ORDER 67—PROCEEDINGS UNDER JUDGMENTSAND
ORDERS†2. Summons to proceed˙Summons to proceed with accounts and
inquiries directed—directions6.(1)A
party entitled to prosecute a judgment or order directing
accountsor inquiries to be taken or made may within
14 days after the entry of suchjudgmentororder,andanypartymaythereafter,issueasummonstoproceed with the accounts or inquiries
directed, and upon the return of thesummonstheJudge,ifsatisfiedbyproperevidencethatallnecessarypartieshavebeenservedwithnoticeofthejudgmentororder,shallthereupon give directions as to the manner in
which each of the accountsandinquiriesistobeprosecuted,theadvertisements(ifany)tobepublished, the evidence to be adduced
in support thereof, the parties who areto attend on the
several accounts and inquiries, the time for adjudicating onclaims, and the time within which any other
proceeding is to be taken, and aday or days may
be appointed for the further attendance of the parties.(2)Any such directions may afterwards be
varied, by addition thereto orotherwise, as may
be found necessary.˙Settling deed in case parties
differ7.When by a judgment or order a deed is
directed to be settled by theJudge in case the
parties differ, the party entitled to prepare the draft deedshall
deliver a copy thereof to the party entitled to object thereto, and
theparty entitled to object shall deliver to the
other party a statement in writing
336Rules of the Supreme Courtof
his or her proposed amendments (if any) within 8 days after the
deliveryof such copy, and, if the party proposes any
amendments which the otherparty is not willing to accept, a
summons shall be taken out to settle thedraft.˙Dispensing with service of notice of
judgment or order8.When, upon the hearing of a summons to
proceed, it appears to theJudge that by reason of absence, or for
any other sufficient cause, personalservice of notice
of the judgment or order upon any party cannot be made orought
to be dispensed with, the Judge may at the Judge’s discretion
orderany substituted service or notice by
advertisement or otherwise in lieu ofsuch
service.˙Power to bind persons when service
dispensed with9.When personal service of notice of a
judgment or order for accountsand inquiries is
dispensed with, the Judge may, if the Judge thinks fit,
orderthat the persons as to whom such service is
dispensed with shall be boundas if served, and
they shall be bound accordingly, except when the judgmentor
order has been obtained by fraud or non-disclosure of material
facts.˙Stay of proceedings where all necessary
parties have not been servedwith notice of
judgment or order10.Ifonthehearingofasummonstoproceeditappearsthatallnecessary parties are not parties to
the action, or have not been served withnotice of the
judgment or order, directions may be given for
advertisementsfor creditors; but the adjudication on
creditors’ claims and the accounts shallnot be proceeded
with, and no other proceedings shall be taken, except forthepurposeofascertainingthepartiestobeserved,untilallnecessarypartieshavebeenservedandarebound,orpersonalservicehasbeendispensed with,
and until directions have been given as to the parties whoare
to attend on the proceedings.˙Course
of proceeding at chambers—papers for use of Judge11.(1)The course of
proceeding in chambers under a judgment or order
337Rules of the Supreme Courtshallordinarilybethesameasthecourseofproceedingincourtuponmotions.(2)Copies, abstracts, or extracts of or from
accounts, deeds, or otherdocumentsandpedigreesandconcisestatementsshall,ifdirected,besupplied for the use of the Judge, and when
so directed, copies shall behanded to the
other parties.(3)Butnocopiesshallbemadeofdeedsordocumentswhentheoriginals can be brought in, unless the
Judge so directs.†3. Attendances˙Classifying interests of parties—costs of
party appearing separately12.When upon the
hearing of the summons to proceed, or at any timeduring the prosecution of the judgment or
order, it appears to the Judge,with respect to
the whole or any portion of the proceedings, that the
interestsofthepartiescanbeclassified,theJudgemayrequirethepartiesconstituting each
or any class to be represented by the same solicitor, andmay
direct what parties may attend all or any part of the proceedings;
and, ifthe parties constituting any class cannot
agree upon the solicitor to representthem, the Judge
may direct that any of the parties constituting such classwho
insists upon being represented by a separate solicitor shall
personallypay the costs of his or her own solicitor of
and relating to the proceedings inquestion,andallsuchfurthercostsasmaybeoccasionedtoanyoftheparties by his or her being represented by a
separate solicitor.˙Judge may require separate solicitor to
represent parties13.Whenever in any proceeding before a
Judge in chambers the samesolicitor is employed for 2 or more
parties, the Judge may at the Judge’sdiscretionrequirethatanyofthepartiesshallberepresentedbeforetheJudge by a separate solicitor, and may
adjourn the proceedings until suchparty is so
represented.
338Rules of the Supreme Court˙Attendance of parties not directed to
attend14.Any of the parties other than those
who have been directed to attendmayattendattheirownexpense,anduponpayingthecosts(ifany)occasionedbysuchattendance;or,iftheythinkfit,theymayapplybysummons for liberty to attend at the expense
of the estate, or to have theconduct of the
action either in addition to or in substitution for any of
theparties who have been directed to
attend.†4. Reference to registrar˙Accounts etc. to be taken by
registrar15.Accounts shall be taken, and inquiries
shall be made, by the Masteror, at a place
other than Brisbane, if no Master is sitting at that place
theregistrar as the Judge’s deputy without any
special order of reference to himor her, unless
otherwise ordered by the Court or Judge.˙Powers
of registrar16.The registrar shall, for the purpose
of any proceedings directed to betakenbeforetheregistrar,havefullpowertoissueadvertisements,tosummonpartiesandwitnesses,toadministeroaths,torequiretheproductionofdocuments,totakeaffidavitsandacknowledgments,andunless otherwise ordered, to examine parties
and witnesses viva voce.˙Duty of persons
summoned to attend before registrar17.Parties and witnesses summoned to attend
before the registrar shallbe bound to attend in pursuance of the
subpoena, and shall be liable to thesame consequences
in case of default in attendance as in the case of defaultin
attendance in pursuance of a writ of subpoena in any other
case.˙Reference to Judge18.Any
party may require any question arising before the registrar to
beadjournedbeforetheJudgefortheJudge’sopinionthereon,andtheregistrarshallactupontheopinionoftheJudgeaccordingly;butthe
339Rules of the Supreme CourtdecisionoftheJudgeshallnotbedeemedtobefinallygivenuponanymatter so referred to the Judge until
the filing of the registrar’s certificateembodying the
result of the Judge’s opinion.†5.
Accounts˙Special directions as to mode of taking
account19.When an account is directed to be
taken, the Court or a Judge may,either by the
judgment or order directing the account, or by any
subsequentorder, give special directions with regard to
the mode in which the accountis to be taken or
vouched, and in particular may direct that in taking theaccount, the books of account in which the
accounts in question have beenkept shall be
taken as prima facie evidence of the truth of the matters
thereincontained,withlibertytothepartiesinterestedtotakesuchobjectionsthereto as they
may be advised.˙Accounts to be verified by affidavit
numbered and left in registry20.(1)Whenanaccountisdirectedtobetaken,theaccountingpartyshall, unless the Court or a Judge otherwise
directs, make out his or heraccount and
verify the same by affidavit.(2)Theitemsoneachsideoftheaccountshallbenumberedconsecutively,
and the account shall be referred to by the affidavit as anexhibit, and shall be left in the registry
within the time directed by the Courtor Judge.˙Mode of vouching accounts21.(1)Upon the taking
of any account the payment of all sums exceeding£10($20)shallbevouchedbyproperreceiptssignedbythepersonstowhom
the payments are alleged to have been made, unless the Court or
aJudge otherwise orders.(2)The
Court or a Judge may direct that the vouchers shall be
producedattheofficeofthesolicitoroftheaccountingparty,oratanyotherconvenientplace,andthatonlysuchitemsasmaybecontestedorsurcharged shall be brought before the
registrar or Judge in chambers.
340Rules of the Supreme Court˙Surcharge22.Any
party seeking to charge any accounting party for an amount
inexcess of that which the party has by his or
her account admitted to havereceived shall
give notice thereof to the accounting party, stating, so far
asthepartyisable,theamountsoughttobecharged,andtheparticularsthereof, in a
short and succinct manner.˙Inquiry as to
personalty23.Every judgment or order for a general
account of the personal estateof a testator or
intestate person shall contain a direction for an inquiry
whatparts(ifany)ofsuchpersonalestateareoutstandingorundisposedof,unless the Court or a Judge otherwise
directs.˙Accounts and inquiries to be
numbered24.Whenbyanyjudgmentororder,whethermadeincourtorinchambers, any accounts are directed to
be taken or inquiries to be made,each direction
shall be numbered so that, as far as may be, each distinctaccount and inquiry may be designated by a
number; and such judgment orordershallbeintheforminschedule1,withsuchvariationsascircumstances may require.˙Just allowances25.Intakinganyaccountdirectedbyanyjudgmentororder,alljustallowances shall
be made without any direction for that purpose.˙Registrar to report delay26.The
registrar shall from time to time report to the Judge any case
inwhichtheregistrarconsidersthattherehasbeenanyunduedelayinprosecuting any account or
inquiry.˙Expediting proceedings in case of undue
delay27.If it appears to the Court or a Judge,
on the representation of theregistrar, that
there is any undue delay in the prosecution of any accounts
or
341Rules of the Supreme Courtinquiries,orinanyotherproceedingsunderanyjudgmentororder,theCourt
or Judge may require the party having the conduct of the
proceedings,or any other party, to explain the delay, and
may thereupon make such otherorder with regard
to expediting the proceedings or the conduct thereof, orthe
stay thereof, and as to the costs of the proceedings, as the
circumstancesof the case may require; and, for the
purposes aforesaid, any party or theregistrarmaybedirectedtosummonthepersonswhoseattendanceisrequired, and to conduct any proceedings and
carry out any directions whichmay be given; and
any costs incurred by the registrar in obedience to anysuch
order shall be paid by such parties or out of such funds as the
Court orJudge may direct; and if any such costs are
not otherwise paid, the sameshallbepaidoutofsuchmoneys(ifany)asmaybeprovidedbyParliament.˙Evidence28.Any
person attending before the Judge or the registrar as a
witnessmay be examined or cross-examined on oath as
upon the trial of a cause.†6. Creditors and
claimants˙Claimants not coming in to prove etc.
excluded29.When a judgment or order is given or
made, whether in court or inchambers,
directing an account of debts, claims, or liabilities, or an
inquiryfor heirs, next of kin, or other
unascertained persons, all persons who donot come in and
prove their claims within the time fixed for that purpose byadvertisement shall, unless otherwise
ordered, be excluded from the benefitof the judgment
or order.˙Advertisements30.(1)Whenanadvertisementisrequiredforthepurposeofanyproceeding in chambers, a peremptory
advertisement, and only 1, shall bepublished,unlessforsomespecialreasontheJudgedirectsasecondadvertisement or
further advertisements to be published.
342Rules of the Supreme Court(2)Buteveryadvertisementshallbepublishedasmanytimesandinsuch papers as
may be directed.˙By whom prepared and signed31.An advertisement for creditors and
other claimants shall be preparedbythepartyprosecutingthejudgmentororder,andsubmittedtotheregistrar for approval, and when
approved shall be signed by the registrar,and such
signature shall be sufficient authority to the Government Printer
toinsert the same in the Gazette.˙Substance and form of
advertisement32.(1)Advertisements
for creditors and other claimants shall fix a timewithin which each claimant, not being a
creditor, is to come in and prove hisor her claim, and
within which each creditor is to send to the executor oradministratorofthedeceased,ortosuchotherpartyastheJudgemaydirect,ortohisorhersolicitor,tobenamedanddescribedintheadvertisement, the name and address of
such creditor and the full particularsof his or her
claim, and a statement of his or her account and the nature
ofthe security (if any) held by him or
her.(2)Such advertisements shall be in one of
the forms in schedule 1, withsuch variations
as the circumstances of the case may require.˙Unless
served with notice, creditors need not attend33.A
creditor need not make an affidavit nor attend in support of
thecreditor’s claim, except to produce his or
her security, unless the creditor isserved with a
notice requiring the creditor to do so as hereinafter
provided.˙Creditors to produce their securities,
and evidence of their debts ifrequired34.Every creditor shall produce the
security (if any) held by the creditorbefore the
registrar at a time to be specified in the advertisement for
thatpurpose, which shall be the same as the time
appointed for adjudicating onthe claims; and
every creditor shall, if required, by notice in writing, in
theform in schedule 1, which shall be given by
the executor or administrator of
343Rules of the Supreme Courtthe
deceased, or by such other party as the Judge may direct, produce
allother deeds and documents necessary to
substantiate the creditor’s claimbefore the
registrar at a time to be specified in such notice.˙Creditor neglecting notice to lose
costs35.If a creditor neglects or refuses to
comply with the requirements ofthe notice
mentioned in rule 34, the creditor shall not be allowed any
costsof proving his or her claim, unless the Judge
so directs.˙Examination and verification of
claims36.The executor or administrator of the
deceased, or such other party asthe Judge may
direct, shall examine the claims of creditors sent in
pursuanttotheadvertisement,andshallascertain,sofarastheJudgeisable,towhich
of such claims the estate in course of administration is justly
liable,and the Judge shall, at least 7 clear days
prior to the time appointed foradjudication,
file an affidavit in the form in schedule 1, to be made by
suchexecutor or administrator, or 1 of the
executors or administrators, or suchotherparty,eitheraloneorjointlywithhisorhersolicitororothercompetent person,
or otherwise as the Judge may direct, verifying a list, inthe
form in schedule 1, of the claims whereof particulars have been
sent inpursuant to the advertisement, and stating to
which of such claims, or partsthereof
respectively, the estate is in the opinion of the deponent justly
liable,and his or her belief that such claims, or
parts thereof respectively, are justlydue and proper to
be allowed, and the reasons for such belief.˙Affidavit verifying claims may be
postponed37.The Judge may direct that the making
of the affidavit referred to inrule 36 shall be
postponed till after the day appointed for adjudication, andmay
give such directions as the Judge thinks fit with respect to
it.˙Adjournment—further evidence38.If on the day appointed for hearing
the claims any of them remainundisposed of, a
later day for hearing such claims shall be fixed, and, iffurther evidence is to be adduced, a time may
be named within which the
344Rules of the Supreme Courtevidence on both sides is to be closed, and
directions may be given as to themode in which
such evidence is to be given.˙Adjudication on the claims39.At the time appointed for adjudicating
upon the claims of creditors,or at any
adjournment thereof, the registrar may in the registrar’s
discretionallow any of the claims, or any part thereof
respectively, without proof bythe creditors,
and may direct such investigation of all or any of the
claimsnot allowed, and require such further
particulars, information, or evidencerelating thereto,
as the registrar may think fit; and may, if the registrar
thinksfit, require any creditor to attend and prove
the creditor’s claim, or any partthereof: and the
adjudication on such claims as are not then allowed shall beadjourned to a time to be then fixed.˙Notice to creditors of claims allowed
or disallowed40.(1)Notice of
allowance, in the form in schedule 1, shall be given bythe
party prosecuting the judgment or order to every creditor whose
claim,or any part of whose claim, has been allowed
without proof by the creditor.(2)When
the claim, or part of the claim, of any creditor is not
allowed,but no direction is given as to the further
investigation thereof under rule 39,notice, in the
form in schedule 1, shall be given by the party prosecuting
thejudgment or order to such creditor requiring
the creditor to prove his or herclaim, or such
part thereof as is not allowed, by a time to be named in thenotice, not being less than 7 days after the
service of the notice, and to attendat a time to be
therein named, being the time to which the adjudicationthereon has been adjourned.(3)If any creditor fails to comply with
such notice, the creditor’s claim,orsuchpartthereofasaforesaid,shallbedisallowed,unlesstheJudgeotherwise
orders.˙Claims after expiration of time
fixed41.After the time fixed by the
advertisement no claims shall be received,exceptashereinbeforeprovidedincaseofanadjournment,exceptbyspecial leave of the Judge, upon
application made by summons, and then
345Rules of the Supreme Courtupon
such terms and conditions as to costs and otherwise as the Judge
maythink fit.˙Costs
of creditor proving his or her debt42.Acreditorwhohascomeinandprovedhisorherdebtunderajudgment or order shall be entitled to the
costs of so proving the debt, andthe sum to be
allowed for such costs shall be fixed by the registrar,
unlessthe registrar thinks fit to direct the
taxation thereof; and the amount of suchcosts, or the sum
allowed in respect thereof, shall be added to the debt soproved.˙List
of claims allowed43.A list of all claims allowed shall,
when required by the registrar, bemade out and left
in the registry by the person who examines the claims.˙Payment of creditors44.Whenanyjudgmentororderisgivenormadeforpaymentofmoney
in court to creditors, the party whose duty it is to prosecute
suchjudgment or order shall send to each such
creditor, or the creditor’s solicitor(if any) a notice
in the form in schedule 1, that the cheques may be receivedfromtheTreasurer;andsuchpartyshall,whenrequired,producesuchjudgment or order
and any other papers necessary to enable such creditorsto
receive their cheques.˙Service of notices
under this order45.Every notice by this order required to
be given to creditors or otherclaimants shall,
unless the Judge otherwise directs, be deemed sufficientlygivenandservediftransmittedbypostprepaidtothecreditororotherclaimant to be
served according to the address given in the claim sent in
byhimorherpursuanttotheadvertisement,or,ifsuchcreditororotherclaimant has
employed a solicitor, to such solicitor according to the
addressgiven by him or her.
346Rules of the Supreme Court†7. Interest˙Computation of interest on debts bearing
interest46.When a judgment or order is given or
made directing an account ofthe debts of a
deceased person, interest shall, unless otherwise ordered,
becomputed on such debts as to such of them as
carry interest after the ratethey respectively
carry, and as to all others after the rate of 4% per annumfrom
the date of the judgment or order.˙Allowance of interest on debts not carrying
interest47.Acreditorwhosedebtdoesnotcarryinterest,whocomesinandproves the same under a judgment or
order of the Court or a Judge, shall beentitled to
interest upon the creditor’s debt at the rate of 4% per annum
fromthe date of the judgment or order out of any
assets which may remain aftersatisfying the
costs of the cause or matter, the debts proved, and the
interestof such debts as by law carry
interest.˙Interest on legacies48.When a judgment or order is given or
made directing an account oflegacies,
interest shall be computed on such legacies after the rate of 4%
perannum from the end of 1 year after the
testator’s death, unless otherwiseordered, or
unless any other time of payment or rate of interest is
directedby the will, and in that case according to
the will.†8. Certificates of the
registrar˙Registrar’s certificate49.(1)The result of
proceedings before the registrar shall be stated in theshape
of a concise certificate.(2)It shall not be
necessary for the Judge to sign such certificate, andunless an order to discharge or vary the same
is made, the certificate shallbe deemed to be
approved and adopted by the Judge.
347Rules of the Supreme Court˙Reference to judgment etc.50.The certificate of the registrar shall
not, unless the circumstances ofthecaserenderitnecessary,setoutthejudgmentororder,oranydocuments or evidence or reasons, but
shall refer to the judgment or order,documents, and
evidence, or particular paragraphs thereof, so that it mayappear upon what the result stated in the
certificate is founded.˙Preparation and
settlement of certificate51.(1)Thecertificateshall,unlesstheJudgeotherwisedirects,beprepared by the party having the prosecution
of the judgment or order, whoshall obtain an
appointment to settle the certificate, and shall give notice
ofsuch appointment to the other parties.(2)No summons to settle the certificate
shall be issued.˙Form of certificate52.The
certificate shall be in the form in schedule 1, with such
variationsas the circumstances may require, and when
prepared and settled shall betranscribed in
such form and within such time as the registrar may require,andshallbesignedbytheregistrareitherthenor,ifnecessary,atanadjournment to be made for the
purpose.˙Contents of certificate in cases of
accounts—transcript—filing ofaccounts and
transcripts53.(1)When an account
is directed, the certificate shall state the results ofsuch
account, and not set the same out by way of schedule, but shall
refer tothe account verified by the affidavit filed,
and shall specify by the numbersattached to the
items in the account which (if any) of such items have beendisallowed or varied, and shall state what
additions (if any) have been madebywayofsurchargeorotherwise;and,iftheaccountverifiedbytheaffidavit has been so altered that it
is necessary to have a fair transcript ofthe account as
altered, such transcript may be required to be made by theparty
prosecuting the judgment or order, and shall then be referred to by
thecertificate.(2)The
accounts and the transcripts (if any) referred to in the
certificate
348Rules of the Supreme Courtshall
be filed therewith.(3)No copy of any such account shall be
required to be taken by anyparty.˙Taking opinion of Judge54.Anypartymay,beforetheproceedingsbeforetheregistrarareconcluded, take the opinion of the Judge upon
any matter arising in thecourse of the proceedings without any
fresh summons for the purpose.˙When
certificate becomes binding application to discharge or vary
it55.Every certificate shall be filed in
the registry, and shall thenceforth bebinding on all
the parties to the proceedings, unless discharged or variedupon
application to the Court or a Judge to be made before the
expiration of8 clear days after the date of the filing of
the certificate; or, in the case ofcertificateswhicharetobeacteduponbytheTreasurerwithoutfurtherorder, or certificates on passing receivers’
accounts, within 2 clear days afterthe date of the
filing of the certificate.˙Discharge or
variation after any lapse of time56.The
Court or a Judge may, nevertheless, in any case, if the
specialcircumstances make it just to do so, order a
certificate to be discharged orvaried,
notwithstanding that it has become binding on the parties.˙Computation of interest etc. to be
acted upon by Treasurer etc.57.The
Court or a Judge may direct any computation of interest, or
theapportionment of any fund, to be certified by
the registrar, and to be actedupon by the
Treasurer or other person without further order.†9. Further consideration˙Setting down cause or matter for
further consideration58.(1)When the further
consideration of any cause or matter has at the
349Rules of the Supreme Courtoriginaloranysubsequenthearing,whetherincourtorchambers,beenadjourned for the purpose of taking any
accounts, or making any inquiries,such cause or
matter may, after the expiration of 8 days, and within 14
daysfromthedateofthefilingoftheregistrar’scertificate,besetdownforfurther consideration in court or chambers,
as the case may be, by the partyhaving the
prosecution of the judgment or order, and after the expiration
ofsuch 14 days by any other party.(2)Six clear days notice shall be given
by the party so setting down thecause or matter
to the opposite party that the same has been so set down.†10. References in admiralty
actions˙Application of rules59.Rules 60 to 72 shall apply to
references by the Court or a Judge to theregistrar,
whether the reference is to the registrar alone, or to the
registrarassisted by a merchant or merchants.˙Reference to registrar and
merchants60.(1)The Court or
Judge may refer the assessment of damages and thetaking of any account to the registrar,
either alone or assisted by a merchantor
merchants.(2)The appointment of the merchants shall
be made in the same manneras that of assessors.˙Filing of claim and affidavits61.Within12daysfromthedaywhentheorderforthereferenceismadetheclaimantshallfilehisorherclaimandhisorheraffidavitsverifying the
same; and within 12 days from the day when the claim andaffidavits are filed, the adverse party shall
file his or her counter affidavits.˙Filing
of further affidavits62.After the filing
of the counter affidavits, 6 days shall be allowed toeitherpartyforfilingfurtheraffidavits,andafterthatperiodnofurther
350Rules of the Supreme Courtaffidavitsshallbefiled,unlessbyorderoftheCourtoraJudge,orbypermission of the registrar.˙Time for hearing63.Within 3 days from the expiration of the
time allowed for filing thelast affidavits,
the claimant shall file in the registry a notice, praying to
havethe reference set down for hearing, and if
the claimant does not do so, theadversepartymayapplytotheCourtoraJudgetohavetheclaimdismissed with
costs.˙Hearing64.At
the time appointed for the reference, if either party is present,
thereferencemaybeproceededwith;buttheregistrarmayadjournthereference from time to time as the registrar
may deem proper.˙Witnesses65.Witnesses may be produced before the
registrar for examination, andthe evidence may,
on the application of either party, but at the expense in
thefirst instance of the party on whose behalf
the application is made, be takendown by a
shorthand writer or reporter appointed by the Judge, who
shallbe sworn faithfully to report the evidence;
and a transcript of the shorthandwriter’s or
reporter’s notes, certified by the shorthand writer or reporter
tobe correct, shall be admitted to prove the
oral evidence of the witnesses onan objection to
the registrar’s report.˙Counsel66.Counsel may attend the hearing of any
reference, but the expensesattendingtheemploymentofcounselshallnotbeallowedontaxation,unlesstheregistrarisofopinionthattheattendanceofcounselwasnecessary.˙Report
by registrar67.(1)When a reference
has been heard, the registrar shall make a report
351Rules of the Supreme Courtin
writing of the result in the form of a certificate, showing the
amount (ifany) found due, and to whom, together with
any further particulars that maybe
necessary.(2)The certificate shall be in the same
form as directed in the case ofcertificates in
other actions.˙Costs68.The
registrar may, if the registrar thinks fit, report whether any
andwhat part of the costs of the reference
should be allowed, and to whom.˙Notice
to parties69.When the report is ready, notice shall
be sent to the parties, and eitherparty may
thereupon take up and file the report.˙Motion
to vary70.Within 2 weeks from the date of the
filing of the registrar’s report,either party may
give notice of motion to vary the report, specifying theitems
objected to.˙Order thereon71.At
the hearing of the motion the Judge may make such order
thereonas the Judge thinks just, or may remit the
matter to the registrar for furtherinquiry or
report.˙Confirmation if no motion to
vary72.If a notice of motion to vary the
report is not filed within 2 weeksfrom the date of
the filing of the registrar’s report, the report shall standconfirmed.
352Rules of the Supreme Court†ORDER 68—SALES BY THE COURT†1. In ordinary actions˙Power of Court to order sale of real
estate1.In any cause or matter relating to any
real estate, in which it appearsnecessary or
expedient that the real estate or any part thereof should be
soldbefore judgment in the cause or matter, an
order for the sale may be madebytheCourtoraJudgeatanytimeafterthenecessityorexpediencybecomes
apparent.˙Abstract of title to be laid before
conveyancing counsel2.(1)When any land is
ordered to be sold under a judgment or order, theCourt
or Judge may order that an abstract of the title be laid before
somecounsel approved by the Court or Judge for
counsel’s opinion thereon, soas to enable
proper directions to be given respecting the conditions of
saleand other matters connected with the
sale.(2)In any such case the conditions of
sale shall specify a time for thedeliveryoftheabstractoftitletothepurchaserortothepurchaser’ssolicitor.˙Sale with the approbation of the
Judge3.When a judgment or order is given or
made, whether in court or inchambers,directinganypropertytobesold,thesameshall,unlessotherwise
ordered, be sold by auction, with the approbation of the Judge,
tothe best purchaser that can be got, the
purchase being allowed by the Judge;and all such
parties shall join in the sale and conveyance as the Judge
shalldirect.˙Order
for payment of purchase-money into court not necessary4.An order for the payment of
purchase-money into court shall not benecessary, but a
direction for that purpose signed by the registrar shall besufficient authority for the Treasurer to
receive the money.
353Rules of the Supreme Court˙Mode of carrying out sale, mortgage,
partition, or exchange, whenordered by
Court5.(1)In any case in
which a sale, mortgage, partition, or exchange, isordered, the Court or a Judge shall have
power, with a view to avoidingexpenseordelay,orforothergoodreason,toauthorisethesametobecarried out, either—(a)by auction; or(b)bylayingaspecificproposalforsalebeforetheJudgefortheJudge’s sanction; or(c)byproceedingsaltogetheroutofcourt,anymoneysproducedthereby being paid into court or to
trustees, or otherwise dealtwith as the
Judge may order.(2)However, proceedings altogether out of
court shall not be authorised,unless and until
the Judge is satisfied, by such evidence as the Judge maydeemsufficient,thatallpersonsinterestedintheestatetobesold,mortgaged,
partitioned, or exchanged, are before the Court or are bound
bythe order for sale, mortgage, partition, or
exchange.(3)Every order authorising a sale by
proceedings altogether out of courtshall be prefaced
by a declaration that the Judge is so satisfied as
aforesaid,and a statement of the evidence upon which
such declaration is made.˙Power to make
order for sale in debenture-holders’ action at any time6.In debenture-holders’ actions, when
the debenture-holders are entitledto a charge by
virtue of the debentures, or of a trust deed or otherwise,
andtheplaintiffissuingonbehalfofhimselforherselfandotherdebenture-holders, if the Judge is of opinion
that there must eventually be asale, the Judge
may in the Judge’s discretion direct a sale before judgment,and
also may direct a sale after judgment, although all the persons
interestedare not ascertained, and whether the judgment
has been served on any ofthem or not.˙Conduct of sale of trust estates7.When in an action for the
administration of the estate of a deceasedperson, or
execution of the trusts of a written instrument, a sale is
ordered
354Rules of the Supreme Courtof
any property vested in any executor, administrator, or trustee, the
conductof such sale shall be given to such executor,
administrator, or trustee, unlessthe Court or a
Judge otherwise directs.˙Form of affidavit
of value8.AffidavitsforthepurposeofenablingtheJudgetofixreservedbiddingsuponasalebyauctionshallstatethevalueofthepropertybyreference to an exhibit containing such
value, so that the value may not bedisclosed by the
affidavit when filed.˙Prints of
particulars and conditions of sale9.As
soon as particulars and conditions of sale have been settled, a
printthereof, certified by the solicitor to be a
correct print of the particulars andconditions as
settled, shall be left at the registry.˙Certificate of result of sale to be made by
auctioneer and solicitor inlieu of affidavit10.(1)IneverycaseofasaleunderthedirectionoftheCourttheparticulars of sale shall be signed by, and
the result of the sale shall becertified under
the hands of, the auctioneer and the solicitor of the partyhaving the conduct of the sale.(2)It shall not be necessary to file any
affidavit verifying the particularsor the result of
the sale.(3)The form in schedule 1 shall be used,
with such variations as thecircumstances may
require.†2. Appraisement and sale etc. in
admiralty actions˙Appraisement11.In
admiralty actions the Court or a Judge may, either before or
afterfinaljudgment,orderanypropertyunderthearrestoftheCourttobeappraised, or to be sold without
appraisement, and either by public auctionor by private
contract.
355Rules of the Supreme Court˙Sale of perishable property12.If the property is deteriorating in
value, the Court or a Judge mayorder it to be
sold forthwith.˙Without commission in certain
cases13.If the property to be sold is of small
value, the Court or a Judge may,if the Court or
Judge think fit, order it to be sold without a commission ofsale
being issued.˙Removal of property14.The
Court or a Judge may, either before or after final judgment,
orderany property under arrest of the Court to be
removed, or any cargo underarrest on board
ship to be discharged.˙Commissions15.The appraisement, sale, and removal of
property, the discharge ofcargo, and the demolition and sale of a
vessel condemned under any SlaveTradeAct,shall,exceptasprovidedbyrule13,beeffectedundertheauthority of a commission, which,
unless the Court or a Judge otherwiseorders, shall be
addressed to the marshal, and executed by the marshal orthe
marshal’s officers.˙Return of commission16.The commission shall, as soon as
possible after its execution, be filedby the marshal,
with a return setting forth the manner in which it has beenexecuted.˙Gross
proceeds of sale to be paid into court17.The
marshal shall pay into court the gross proceeds of sale of
anyproperty which has been sold by the marshal,
and shall at the same timebring into the registry the account of
sale, with vouchers in support thereof,for taxation by
the taxing officer, who shall proceed to tax the same.
356Rules of the Supreme Court˙Taxation of marshal’s expenses18.Any person interested in the proceeds
may be heard before the taxingofficeronthetaxationofthemarshal’saccountofexpenses,andanobjection to the taxation shall be
heard in the same manner as an objectionto the taxation
of a solicitor’s bill of costs.†ORDER 70—APPEALS AND NEW TRIALS†1. Appeals˙Appeals to be by way of rehearing1.Appeals to the Court of Appeal from
judgments or orders of Judgesof the Supreme
Court, whether in court or chambers, shall be by way ofrehearing.˙Mode
of instituting appeals2.(1)Appealsshallbeinstitutedbynoticeofappeal,whichshallbeservedandfiledashereinafterprovided;andnopetition,case,orotherformal proceeding
other than such notice of appeal shall be necessary.(1A)The appellant
may by the notice of appeal appeal from the whole orany
part of the judgment or order appealed from.(2)The
notice of appeal shall state—(a)whether the whole or part only, and what
part, of the judgment ororder is appealed from; and(b)briefly, but specifically, the grounds
of the appeal; and(c)what judgment or order the appellant
seeks in lieu of that appealedfrom.
357Rules of the Supreme Court˙To whom notice to be given3.(1)Notice of appeal
shall be served upon all parties directly affected bythe
appeal, and it shall not be necessary to serve parties not so
affected; butthe Court of Appeal may direct notice of the
appeal to be served on all orany parties to
the cause or matter, or upon any person not a party, and in
themeantime may postpone or adjourn the hearing
of the appeal upon suchterms as may be just, and may give such
judgment and make such order asmight have been
given or made if the persons served with such notice hadbeen
originally parties.(2)Any notice of appeal may be amended at
any time as the Court ofAppeal may think fit.˙Serving of notice of appeal4.(1)The notice of
appeal must be served within 28 days of the day onwhich
the judgment or order is pronounced or within any extended
timeallowed by the Court or a Judge.(2)The times of the vacations are to be
reckoned in the computation ofthe period of 28
days.(3)Withinthetimeprescribedforservingthenoticeofappeal,theappellant must file—(a)an
original notice in the office of the registrar at Brisbane;
and(b)a copy of the notice in the office of
the registrar at the place inwhich the
proceedings were commenced.(4)The appeal is
instituted once the notice of appeal has been duly servedand
filed.˙Payment of security or deposit5.(1)Unless the Court
otherwise orders—(a)the dismissal of an appeal is
sufficient authority for the registrarof the Court in
which any security or deposit has been lodged topaythesecurityordeposittothesuccessfulrespondentorrespondents; and(b)the
allowance of an appeal with costs is sufficient authority for
the
358Rules of the Supreme Courtregistrar to pay the security or deposit to
the appellant; and(c)in either case, the payment may be
made to the solicitors on therecord for the
party entitled to the security or deposit.(2)If
the parties agree that an appeal should be dismissed by consent,
theappellant may file in the registry a
memorandum in form 258A signed bytheappellantortheappellant’ssolicitorsandbytherespondentortherespondent’s solicitors.(3)Amemorandumthatisfiledundersubrule(2)andsealedbytheregistrar has effect as an order of the
Court—(a)dismissing the appeal by consent;
and(b)providing (according to the terms of
the memorandum) for 1 ormore of the following—(i)that any amounts paid into court by
way of security for, ordeposited to answer, the costs of the
appeal, be paid out ofcourt to a specified party or that
party’s solicitors;(ii)that the
appellant pay the respondent’s costs of the appeal, tobe
taxed;(iii)that there be no
order as to costs of the appeal;(iv)that
the appellant pay the respondent’s costs of the appealfixed by consent at a specified
amount;(v)that the appellant pay the
respondent’s costs of the appealand that the
costs be paid out of any amounts paid into courtby
way of security for, or deposited to answer, the costs ofthe
appeal, and that the balance (if any) of the amounts bepaid
out of court to a specified party or that party’s
solicitors.˙Appeals from refusal of ex parte
applications6.(1)WhenanexparteapplicationhasbeenrefusedbyaJudge,theapplicationmayberenewedexpartebywayofappealtotheCourtofAppeal.(2)The
application may be made at any sitting of the Court of
Appealheld within 4 days, or, in the case of an
application refused by a Judge
359Rules of the Supreme Courtsitting in the central, northern or far
northern district, within 14 days, fromthe day of the
refusal, or within any extended time that the Court of
Appealallows.˙Amendment—further evidence10.(1)The Court of
Appeal shall have all the powers and duties as toamendment and otherwise of the Court or Judge
appealed from, and shallhave full discretionary power to
receive further evidence upon questions offact, which
evidence may be taken either by oral examination in court,
byaffidavit, or by deposition taken before an
examiner or commissioner.(2)Suchfurtherevidencemaybegivenwithoutspecialleaveexceptupon
appeals from final judgments, and in any case as to matters
whichhaveoccurredafterthedateofthedecisionfromwhichtheappealisbrought.(3)Upon
an appeal from a judgment after the trial or hearing of a
causeormatteruponthemerits,suchfurtherevidence,saveastomatterssubsequent as
aforesaid, shall not be admitted except on special grounds.˙Powers of Court on Appeal11.(1)The Court, upon
the hearing of an appeal, shall have power todraw inferences
of fact, not inconsistent with the findings of the jury (ifany)
and to give any judgment and make any order which ought to
havebeen given or made in the first instance, and
to make such further or otherorder as the case
may require.(2)ThepowersaforesaidmaybeexercisedbythesaidCourtnotwithstandingthatthenoticeofappealmaybethatpartonlyofthedecision may be reversed or varied, and
such powers may be exercised infavour of all or
any of the respondents or parties, although such respondentsor
parties may not have appealed from or complained of the
decision.(3)The Court shall have power to make
such order as to the whole orany part of the
costs of appeal as may be just.
360Rules of the Supreme Court˙New trial may be ordered12.If upon the hearing of an appeal it
appears to the Court that a new trialought to be had,
the Court may, if it thinks fit, order that the judgment
shallbe set aside and that a new trial shall be
had.˙Cross appeals13.(1)It
shall not under any circumstances be necessary for a
respondentto give notice of appeal by way of cross
appeal, but if a respondent intendsupon the hearing
of an appeal to contend that the decision appealed fromshould be varied, the respondent shall within
the time prescribed by rule 14,or such time as
may be directed by special order in any case, give notice ofthe
respondent’s intention to the appellant and such other parties as
may beaffected by such contention.(1A)The omission to
give such notice shall not diminish the powers ofthe
Court when hearing the appeal, but may, in the discretion of the
Court,begroundforanadjournmentoftheappealorforaspecialorderastocosts.(2)Thenoticeshallstatewhatpartofthejudgmentorordertherespondentcontendsshouldbevaried,andshallstate,brieflybutspecifically, the grounds of that contention,
and the judgment or order thatthe respondent
seeks.(3)The powers given to the Court by rule
3 shall extend to any suchnotice as though it were a notice of
appeal.(4)It is not necessary to give any such
notice if a respondent proposes tocontendthatsomematteroffactorlawhasbeenerroneouslydecidedagainst the respondent but does not seek a
discharge or variation of a part ofthe judgment,
decree, or order actually pronounced or made.˙Time
for giving of notice and filing of copy of notice14.(1)Forthepurposesofrule13andsubjecttoaspecialordermentioned in the rule, notice of the
respondent’s intention must be givenwithin 7 days of
the service of the notice of appeal on the respondent.(2)Within the 7 days mentioned in subrule
(1) or the time directed by aspecial order
mentioned in rule 13, the respondent must file a copy of
the
361Rules of the Supreme Courtnotice of the respondent’s intention—(a)in the office of the registrar at
Brisbane; and(b)in the office of the registrar at the
place in which the proceedingswere
commenced.˙Notice to registrar14A.A
respondent who gives a notice under rule 13 shall within the
timeprescribed by rule 14 file in the Supreme
Court Office at Brisbane, and, ifthejudgmentororderappealedfromwasinproceedingspendinginaregistry other
than the registry at Brisbane, in such other registry, a copy
ofthe notice.˙Documents to be forwarded15.When
a copy of the notice of appeal has been filed, as provided
byrule 4, in the registry of the Court at the
place in which proceedings werecommenced,theregistraroftheCourtmustforwardtotheregistraratBrisbane all documents that are necessary for
the hearing of the appeal.16.(1)Unless otherwise
directed by the Court of Appeal or a Judge ofAppealorotherpersonauthorisedbythePresidentoftheCourtofAppeal—(a)a
record shall be prepared for use in a proceeding in the Court
ofAppealandthepartybywhomtherecordispreparedshallforthwith serve a copy on each other party
and lodge 4 copies inthe registry at Brisbane; and(b)therecordshallcontainonlythenoticeofappealorotherdocument by
which the proceeding in the Court of Appeal wasinstituted
together with a copy of that part of the record of theproceedings below which is necessary for the
consideration anddetermination of the proceeding in the Court
of Appeal; and(c)the part of the record of the
proceedings below which is to becopied and
included in the record and all matters relating to thepreparation of the record shall be
determined in accordance withthe rules and
practice directions in force from time to time.
362Rules of the Supreme Court(2)Therecordshallbeboundinvolumesnotmorethan40mminthickness which shall be indexed and shall be
prepared and produced in amanner satisfactory to the
registrar.(3)The record shall be comprehensively
and informatively indexed.(4)The costs of
copies of unnecessary documents will not be allowed ontaxation.16A.A
request by the appellant to the State Reporting Bureau to
prepareor cause the preparation of the record with
an undertaking to pay the cost ofpreparation and
any associated work or an undertaking by the appellant tocause
the record to be prepared and lodged forthwith upon the
determinationof the material to be included in the record
in accordance with the rules andpracticedirectionsoranorderordirectionintheproceedingshallbeincluded in the notice of appeal or
other document by which a proceeding isinstituted in the
Court of Appeal or filed and served within 7 days
thereafter.˙Interlocutory orders not appealed from
not to bar relief18.An interlocutory order or rule from
which there has been no appealshall not operate
to prevent the Court of Appeal, upon hearing an appeal,from
giving such decision upon the appeal as may be just.˙Rule nisi on appeal from Central,
Northern or Far Northern Court19.When
on an appeal from the refusal of an ex parte application by
thecentral, northern or far northern judge the
Court of Appeal is of opinion thata rule nisi or
order nisi should have been granted, the Court of Appeal maygrantaruleorordernisireturnablebeforeitselforbeforetheCentral,Northern or Far
Northern Court.†2. New trials˙Applications for new trials of causes heard
before a Judge20.Except as by these rules specially
provided, every application for anew trial or to
set aside a verdict, finding, or judgment in a cause or
matter
363Rules of the Supreme Courtwhere
there has been a trial by a Judge without a jury shall be made
byappeal to the Court of Appeal.˙Applications for new trials of cases
tried by jury to be by notice ofappeal21.(1)An application
for a new trial or to set aside a verdict, finding orjudgment in a cause or matter in which a
verdict has been found by a jurymust be made to
the Court of Appeal.(2)The application must be made by the
giving of a notice of appeal.(3)The
notice of appeal must state—(a)the
grounds of the application; and(b)whetherallorpartonlyoftheverdict,findingorjudgmentiscomplained of.˙Amendment of notice of appeal22.A notice of appeal may be amended at
any time by leave of the Courtof Appeal or a
Judge of Appeal upon the terms that the Court or Judgedecides.˙Time23.(1)Thenoticeofappealmustbeserveduponthepartyinwhosefavour the
judgment was given within 28 days from the conclusion of thetrialorthedateofthepronouncingofthejudgmentuponfurtherconsideration, as
the case may be; or within such extended time as the Courtof
Appeal or a Judge of Appeal may allow.(2)The
times of the vacations shall be reckoned in the computation of
theperiod aforesaid.˙General practice24.Except as aforesaid, all the provisions of
rules 1 to 23 relating toappeals shall apply to applications for
new trials or to set aside verdicts,
364Rules of the Supreme Courtfindings, or judgments in causes or matters
in which a verdict has beenfound by a
jury.˙New trial as to any question25.Anewtrialmaybeorderedonanyquestion,whateverbethegrounds for the
new trial, without interfering with the finding or decisionupon
any other question.˙Power of Court26.Upon
the hearing of an application for a new trial or to set aside
theverdict or finding of a jury, the Court of
Appeal may, if satisfied that it hasbefore it all the
materials necessary for finally determining the questions indispute, or any of them, or for awarding any
relief sought, give judgmentaccordingly,andmayforthatpurposedrawanyinferenceoffactnotinconsistent with the findings of the jury
(if any); or may, if it is of opinionthat it has not
sufficient materials before it to enable it to give
judgment,direct the appeal to stand over for further
consideration, and may direct suchissuesorquestionstobetriedordeterminedandsuchaccountsandinquiries to be taken and made as it
may think fit.†3. General provisions˙Notes of ruling or direction27.If, upon the hearing of an appeal or
application for a new trial or toset aside a
verdict or finding of a jury, a question arises as to the ruling
ordirection of the Judge to a jury or
assessors, the Court of Appeal may haveregard to the
transcript of the proceedings or to the Judge’s notes or
suchother evidence or materials as the Court of
Appeal may deem expedient.˙Appeal for a new
trial not to be stay of proceedings28.(1)An
appeal or proceeding with the object of obtaining a new trial
orof setting aside a verdict or finding or
judgment shall not operate as a stayof proceedings
unless the Court of Appeal or a Judge of Appeal so
orders.
365Rules of the Supreme Court(2)Anysuchordermaybemadeastothewholeoranypartoftheproceedings in
the cause or matter, and may be made upon such terms asthe
Court of Appeal or the Judge of Appeal granting the stay may think
fit.(3)No intermediate act or proceeding
shall be invalidated except so far asthe Court of
Appeal may direct.˙Return of documents to court
below29.(1)When an appeal
or other proceedings in a cause or matter has beendisposed of by the Court of Appeal, the
registrar at Brisbane must transmitto the office of
the registrar in which the proceedings in the court belowwerecommenced,alldocumentsthatarenotrequiredasrecordsoftheCourt of Appeal at Brisbane, together
with details of the judgment or ordergiven on the
appeal.(2)The order of the Court of Appeal must
be drawn up by the registrarin Brisbane and
filed, and a copy of the order must be filed in the registry
ofthe court below, and all necessary
proceedings must be had and taken in theregistry of the
court below as if the order had been made by that court.˙Costs to be taxed in Brisbane30.The costs of appeals and all other
proceedings before the Court ofAppeal under this
order shall be taxed by the taxing officer at Brisbane.†4. Appeals under statutes˙Application of order to appeals32.Where by any Act or regulation
provision is made for an appeal totheCourtofAppealandnoprovisionismadeastothepracticeandprocedure in relation to such appeal
then the provisions of this order shall sofar as possible
apply to such appeal.
366Rules of the Supreme Court†5. Appeals from registrars33.(1)Any person
affected by any order or decision of a registrar mayappeal therefrom to a Judge at
chambers.(2)Such appeal shall be by way of
endorsement on the summons by theregistrar at the
request of any party, or by notice in writing to attend
beforetheJudgewithoutafreshsummons,within5daysafterthedecisioncomplainedof,orsuchfurthertimeasmaybeallowedbyaJudgeorregistrar.(3)Unless otherwise ordered there shall be at
least 1 clear day betweenservice of the notice of appeal and the
day of hearing.†6. Appeals from District Courts34.A party appealing, either by leave or
as of right, from a judgment of aDistrict Court
shall institute an appeal in accordance with order 70, rule
2within the time prescribed in theDistrict Court Rules 1968,
rule 334.35.Upon the filing of a notice of appeal
the provisions of order 70 shall,subject to
theDistrict Courts Act 1967and rules, apply
in relation thereto.˙Return of
records36.(1)When an appeal
has been disposed of by the Court of Appeal theregistrar at
Brisbane must transmit to the registrar of the District Court
alldocuments relating to the appeal that are not
required as records of the Courtof Appeal at
Brisbane, together with details of the judgment or order
givenon the appeal.(2)The
order of the Court of Appeal must be drawn up by the
registrarin Brisbane and filed, and a copy of the
order filed in the registry of theDistrict Court
from which the appeal was brought.
367Rules of the Supreme Court†7. Exercise of appellate jurisdiction
and powers37.(1)Subject to any
Act and to subrules (2) and (3), the jurisdiction andpowers of the Court of Appeal may be
exercised by 1 or more Judges ofAppeal in
proceedings of the following kind—(a)appealsandapplicationsinproceedingsofakindinwhichaMaster may exercise the original
jurisdiction of the Court withouta direction of
the Chief Justice or the consent of the parties;(b)proceedings concerning a matter of
practice and procedure in aproceeding in
the Court of Appeal;(c)applications in
civil proceedings for leave to appeal;(d)applications in civil proceedings for an
extension of time withinwhich to appeal or to apply for leave
to appeal;(e)appeals from the refusal of ex parte
applications.(2)SubjecttoanyAct,thejurisdictionandpowersoftheCourtofAppeal may be exercised by 2 or more Judges
of Appeal in proceedings ofthe following
kind—(a)applicationsincriminalproceedingsforanextensionoftimewithin which to
appeal or to apply for leave to appeal;(b)applications in criminal proceedings for
leave to appeal;(c)appeals by leave other than appeals
against conviction;(d)appeals in which the only matters in
question (apart from costs)are—(i)the amount of damages; or(ii)the value of
goods; or(iii)the amount of
damages and the value of goods;(e)civil proceedings except appeals from
judgments or orders givenor made by a Judge of the Supreme
Court (other than appealsreferred to in subrule (1) or
paragraph (d));(f)proceedings relating to the admission
of barristers and solicitors.(3)ThejurisdictionandpowersoftheCourtofAppealmaynotbe
368Rules of the Supreme Courtexercised by fewer than 2 Judges of Appeal on
an appeal from a Judge ofthe Supreme Court.˙Miscellaneous38.In
any provision of these rules relating to evidence or procedure,
areference to a notice of motion may, where
appropriate, be taken to be areference to a
notice of appeal.†ORDER 71—PROBATE ANDADMINISTRATION—COMMON FORM BUSINESS†1. Applications˙Applications to be made by request1.(1)Everyapplicationforagrantofprobateoradministrationincommonformshallbemadebyrequestinwritingintheforminschedule 1, and shall be supported by an
affidavit in the form applicable tothe circumstances
of the case, sworn by the applicant, and by such otherevidence as the registrar may require.(2)A petition shall not be
necessary.(3)The request need not be served on any
person.˙Affidavits2.(1)Affidavits in support of the request shall
be entitled in the samemanner as the request.(2)They may be sworn before the request
is filed.˙Advertisements3.(1)Fourteendaysatleastbeforeanapplicationisfiledforagrant,
369Rules of the Supreme Courtnotice of the intended application must be
given by the applicant or theapplicant’ssolicitorbyadvertisementpublishedintheGazetteandin2newspaperseachofwhichisanewspaperpublishedatintervalsnotexceeding 7 days.(2)One
of such newspapers must be a local Brisbane, Rockhampton,Townsville or Cairns newspaper, according as
the application is to be madeto the Court at
Brisbane, Rockhampton, Townsville or Cairns, unless thedeceased was resident at a place in
Queensland distant more than 150 kmfrom Brisbane,
Rockhampton, Townsville or Cairns, in which case suchnoticemaybepublishedinsomelocalnewspapercirculatingintheneighbourhood of the place of the
deceased’s residence.(3)The other must
be a newspaper approved by the Chief Justice.(4)Such
approval may be given by a general direction to the registrar
orby a special direction as to any particular
case.(5)The registrar may require such further
advertisements as the registrarmay deem
necessary.˙Notice to claimants3A.(1)An
executor applying for a grant of probate may include in theadvertisements published in accordance with
rule 3 a notice calling upon allpersons having
claims against the estate of the testator to send their
claimsto the executor.(2)Ifprobateisgrantedtosuchexecutortheexecutormay,attheexpirationofthetimenamedintheadvertisement,orthelastoftheadvertisements, for sending in claims,
distribute the assets of the testatoramongst the
parties entitled thereto, having regard to the claims of which
theexecutor then has notice, and the publication
of such a notice in the saidadvertisements
shall be sufficient for the purposes of theTrusts Act
1973.˙Notice to Public
Trustee or Local Deputy Public Trustee in certaincases4.(1)Whenanapplicationforagrantofprobateorlettersofadministration with the will annexed is made
more than 3 months after thedeathofthedeceasedandinallcasesofapplicationsforagrantof
370Rules of the Supreme Courtadministrationinintestacy,acopyofthenoticemustbeservedonthePublic Trustee or Local Deputy Public
Trustee as the case may be 7 daysbefore the
application is heard.(2)Service as
required by this rule may be effected by post.˙Dispensation with notice5.In
cases of urgency the Court or a Judge may dispense with notice
ofapplication for a grant of probate or
administration, or may allow the grantto be made after
less than 14 days notice.˙When deceased
resident out of Queensland6.If the deceased
was resident or died out of Queensland, such otheradvertisements shall be published as the
registrar or the Court or a Judgemay
direct.˙Applications to be made to
registrar7.(1)Applications for
grants of probate or administration may be madein the first
instance to the registrar, who shall have power to make the
grant.(2)The registrar may refer any question
arising upon the application to aJudge, or may
require the application to be made to the Court.(3)Applications to the Court shall be
made by motion.˙Inquiry before grant9.The registrar may in any case make or
cause to be made such inquiriesas the registrar
thinks fit as to the identity of the deceased or of the
applicant,or as to any other matter which appears to
the registrar to require proof orexplanation,andmayrequirethatsuchinquiriesshallbeansweredbyaffidavit.
371Rules of the Supreme Court†2. Probate and letters of
administration with the will˙Affidavit with will, date of
death—certificate of death11.(1)The affidavit of
the applicant in support of an application for agrant
of probate or of administration with the will, must identify the
will(whichmustbeexhibitedtotheaffidavit)andsetforththedateofthetestator’s death and in the case of an
application for probate, the identity ofthe applicant
with the executor named in or designated by the will.(2)If the exact date of death is not
known the circumstances must bestated.(3)A certificate of death must also be
produced or its absence accountedfor.˙Title of applicant for
administration12.Inthecaseofanapplicationforadministrationwiththewill,theapplicant’saffidavitmustalsosetforththefactsgivingrisetotheapplicant’s claim to the grant in the
same manner as prescribed by theserules in the case
of an application for a grant of administration in the case
ofintestacy.˙Attestation proved by attestation
clause13.If the will has an attestation clause
which sets out the manner of itsexecution in such
a way as to show that the provisions of the law relating tothe
execution of wills have been duly complied with, such attestation
clausemay be accepted as sufficient prima facie
evidence of the due execution ofthe will.˙Evidence when no attestation
clause14.If there is no attestation clause, or
if the attestation clause does not setout the manner of
the execution of the will in such a way as to show that itwas
duly executed, the evidence of 1 at least of the subscribing
witnesses, ifeither of them is living, showing that the
provisions of the law were in factcomplied with,
must be procured, if practicable.
372Rules of the Supreme Court˙Evidence when attesting witnesses dead
or absent15.(1)If both the
subscribing witnesses are dead, or if it is not practicableto
obtain the evidence of either of them, the evidence must, if
possible, beobtained of other persons who were present at
the execution of the will.(2)If such evidence
cannot be obtained, evidence must be produced ofthat
fact, and of the handwriting of the subscribing witnesses, and also
ofany other circumstances which may raise a
presumption in favour of thedue execution of
the will.˙Interlineations16.Interlineations and alterations appearing
upon the face of a will shallnotbeincludedintheprobateorlettersofadministration,unlesstheyexisted in the
will or codicil at the time of its execution, or, if they
weremadeafterwards,unlesstheywereexecutedandattestedinthemannerrequired by law,
or unless they have been rendered valid by the re-executionof
the will, or by the subsequent execution of some codicil.˙Proof as to interlineations or
alterations17.When it is proposed to include any
such interlineations or alterationsin the probate or
letters of administration on the ground that they existed inthe
will at the time of execution, then, unless they appear on the face
of thewill to have been duly executed or are duly
accounted for by the attestationclause, proof
must be given of their having existed in the will before itsexecution, except in the case of alterations
which are merely verbal or oftrivial
importance, and are attested by the initials of the attesting
witnesses.˙Erasures18.(1)Erasures and obliterations shall not be
included in the probate orletters of administration unless they
are proved to have existed in the will atthe time of its
execution, or unless the alterations effected by them are
dulyexecutedandattested,orunlesstheyhavebeenrenderedvalidbythere-execution of
the will or by the subsequent execution of some codicil.(2)Ifitisnotshownwhenanysucherasuresandobliterationsweremade,
and the words erased or obliterated are not entirely effaced, but
can
373Rules of the Supreme Courtupon
inspection of the paper be readily ascertained, they shall be
included inthe probate or letters of
administration.˙Explanation of erasures of
importance19.In every case in which words have been
erased which might havebeen of importance, the matter must be
explained by evidence.˙Documents referred
to in will20.If a will contains a reference to any
deed, paper, memorandum, orother document,
of such a nature as to raise a question whether it does ordoesnotformaconstituentpartofthewill,suchdeed,paper,memorandum,orotherdocumentmustbeproduced,oritsabsenceaccounted
for.˙Only existing documents to be
included21.A deed, paper, memorandum, or other
document so referred to shallnot be included
in the probate or letters of administration, unless it was
inexistence at the time when the will was
executed.˙Apparent annexures22.If
there are upon a will any traces of sealing wax or wafers, or
otherappearances leading to the inference that any
paper, memorandum, or otherdocument may have
been annexed or attached to the will, they must beaccountedfor;andifitappearsthattherewasanysuchpaper,memorandum,orotherdocument,itmustbeproduced,oritsabsenceaccounted
for.˙Blind and illiterate persons23.Probate of the will, or administration
with the will, of a blind personor of an
apparently illiterate or ignorant person shall not be granted
unless itis proved that the will was read over to the
deceased before its execution, orthat at the time
of its execution the deceased had knowledge of its
contents.
374Rules of the Supreme Court˙Copy will and
codicils—engrossments25.(1)In applications
for probate or letters of administration the grantshallbeengrossedonspecialengrossmentsheetsofpaperofthekindhitherto
approved.(2)No other paper engrossments shall be
accepted.Arrangement of sheets(3)When
more than 1 engrossment sheet is required, the sheets shall
bearranged in book-form (sheet within
sheet).Spelling and abbreviations(4)Spellingandabbreviationsinthewillshallbefollowedintheengrossment.Dates and
numbers(5)Dates and numbers if written at length
in the will shall be so writtenin the
engrossment; if written in figures in the will they shall be
engrossedin figures.(6)If
there are alterations in the will or codicil, and these alterations
areverified by the signatures or initials of the
testator and witnesses, or by areference in the
attestation clause, or are shown by affidavit to have beenmade
before the execution of the will or codicil, the will or codicil
shall beengrossed fair (and not facsimile), so that
words interlined, or interpolated,appear in the
text and words struck through or obliterated are omitted.(7)But where it is not shown that
material alterations were made beforethe execution of
the will or codicil the alterations shall be excluded fromprobate.(8)In
such case a copy of the will or codicil, as in its original state,
i.e.beforethealterationswereeffected,shallbemadeandlodgedwiththeoriginal for collation with the other
documents to lead to the grant.(9)Where deletions occur in the will and either
it cannot be shown whenthey were made, or evidence is given
that they were made after the will wasexecuted, a copy
of the will restoring the words deleted shall be lodged.(10)If there are
indecipherable words or figures they shall be omittedfrom
the copy, and blank spaces shall be left where the words or
figureswould appear.
375Rules of the Supreme Court(11)Should a will or
any part thereof be written in pencil, a copy of thewill
shall be made in which the pencil-writings are shown in red
ink.Marginal initials(12)Marginal initials of the testator and
witnesses verifying alterationsshall be
omitted.(13)But an
alteration initialled by the testator and by other witnesses
thanthose subscribing to the will or codicil,
shall be engrossed facsimile, withthe initiallings
shown in the margin.Incorporated document engrossed and
registered(14)When a document
is to be incorporated, it shall be engrossed andregistered in its entirety immediately after
the will or codicil which refersto it.Mistakes in engrossments(15)Mistakes in engrossments shall not be erased
but shall be struckthrough with the pen.(16)No
alteration in the name of the testator, executor or legatee, in
theamount of a legacy, or in a date shall be
permitted.Marginal notes(17)Only
such marginal notes as shall be considered to form part of awill
shall be engrossed and registered, and when a reference in the will
tothenotesstatesthattheyformnopartthereofsuchnotesshallnotbeengrossed or registered.(18)Subject to the
provisions of this rule the copy of the will and codicils(if
any) in the engrossment and in the copy of the grant to be filed in
theregistry shall be reproduced by clear
photographic copy instead of beingprintedortypedprovidedtheregistrarmayintheregistrar’sdiscretionaccept any
engrossment or copy grant which contravenes this rule.˙Marginal note26.If
there is no attestation clause to the will there shall be written
in themarginofthegrantamemorandumstatingthenameofthewitnessbywhom
its due execution was proved.
376Rules of the Supreme Court†3. Letters of administration˙Affidavit in case of intestacy27.(1)The affidavit of
the applicant in support of an application for agrant
of administration in the case of intestacy must set forth the date
of thedeath of the deceased person and also set
forth the relationship (if any) ofthe applicant to
the deceased person and show that the applicant is entitled
tothe grant in priority to all other persons
and how the applicant is so entitled,or, if the
applicant is not so entitled, set forth fully the facts on which
theapplicant relies to satisfy the Court that
the grant should be made to theapplicant.(2)If the exact date of death is not
known the circumstances must bestated.(3)A certificate of death must also be
produced or its absence accountedfor.˙Next of kin to be named28.The applicant’s affidavit must also
set forth what other relations ornext of kin the
deceased person left surviving so far as the same can be setforth
by the deponent.˙Notice to next of kin29.When the application for
administration is made by 1 or some onlyof the next of
kin, there being another or other next of kin equally
entitled,the registrar or the Court or Judge may
require notice of the application tobe given to such
other next of kin.˙Grant to attorney of absent
person30.In the case of a person residing out
of Queensland, and otherwiseentitled to
administration, administration may be granted to some personresident in Queensland, acting under a power
of attorney attested to thesatisfaction of
the registrar or Court or Judge.
377Rules of the Supreme Court˙Persons having prior right to be
accounted for31.When administration, with or without
the will, is granted to a personwho is not the
person having the prior right to the grant, the grant shall,
onthe face of it, account for the claims of all
other persons having prior right.˙Limited administration32.Limited administration shall not be granted
to the person entitled to ageneral grant,
except by the Court or a Judge.˙Notice
to persons entitled to general grant33.Limited administration shall not be granted,
except by the Court or aJudge,unlesseverypersonentitledtoageneralgranthasconsented,orrenounced, or has been cited and failed to
appear.˙Limited and special
administration34.In the case of limited or special
administration, the grant shall setforth the
circumstances under which the special or limited grant is
made.˙Grants for benefit of minors36.(1)Grants of
administration may be made to the guardians of minors,and
of infants under the age of 7 years, for their use and benefit
during theirminority.(2)Minors above the age of 7 years may by
writing under their handelect any of their next of kin or a
next friend as a guardian for that purpose.(3)Every such election shall be filed.(4)A written acceptance of such
guardianship shall not be required.(5)An
assignment of a grant of a guardian to a minor above the age
of7 years shall not be necessary.˙Guardians to be assigned by Court or
Judge37.(1)Inthecaseofinfantsundertheageof7yearsnothavinga
378Rules of the Supreme Courttestamentary guardian or a guardian appointed
by the Court, a guardian forthe purpose of
taking administration must be assigned by the Court or aJudge.(2)The
application for the assignment shall be made by the infant by
theinfant’s next friend, and shall be supported
by affidavit, showing that theproposed guardian
is either next of kin to the infant, or that the infant’s
nextof kin is absent from Queensland, or has
renounced his or her right to theguardianship and
consents to the appointment of the proposed guardian, andthat
the proposed guardian is ready to undertake the
guardianship.˙Elected guardian where infants under 7
also interested38.When there are both minors and infants
under the age of 7 years inequal degree, a
guardian elected by the minors may act for the infants totake
a grant without a special appointment.˙Renunciation by minors and infants39.When it is necessary that a grant
should be renounced by a minor orinfant, a
guardian must be specially assigned for that purpose by the
Courtor a Judge.˙Grant
where intestacy not to be made within 30 days of death40.A grant of administration in the case
of intestacy shall not be madebefore the
expiration of 30 days from the death of the deceased without
theorder of the Court or a Judge.˙Administration of estates of persons
without next of kin41.When application is made for
administration, either with or withoutthe will, of the
goods of a person who died without any known relations,notice of the application shall be given to
the Attorney-General.
379Rules of the Supreme Court†4. Notice to other parties
interested˙Summons to persons interested42.(1)Whenthepersonapplyingforagrantofadministrationisnotentitled to the grant in priority to
all other persons, and is not the attorney ofa person who
being otherwise so entitled is absent from Queensland, theapplicant shall, unless the Court or a Judge
otherwise orders, take out asummonsupontherequestrequiringallpersonsinQueenslandwhoareentitled to the grant in priority to
the applicant, and who have not renouncedadministration,
to attend on the hearing of the application and show causewhy
it should not be granted to the applicant.(2)The
summons shall limit the same number of days for appearance
asin the case of a writ of summons in an
action, and shall be served in thesame manner as a
writ of summons.˙Summons to next of kin at large43.(1)In the case of
persons dying intestate without any known relations,the
applicant shall take out a summons in like manner, directed to the
nextof kin (if any) and all persons having or
pretending to have any claim uponthe estate of the
deceased person.(2)Every such summons shall be served by
posting up in the registry,and by
publication in the Gazette and in such papers as a Judge may
direct.(3)It shall also be served upon the
Attorney-General.˙Appearance to be entered44.Anypersonwhoissummonedtoattendonthehearingoftheapplication for administration, and who
desires to oppose the grant, mustenter an
appearance to the summons in the same manner as in the case
ofappearance to a writ of summons in an
action.˙Hearing—grant45.(1)When
an appearance has been entered to a summons the registrarshallappointadayforproceedingswiththeapplication,ofwhichday
380Rules of the Supreme Court2
days notice shall be given by the applicant to the other
party.(2)If either party requires it, the
application shall be referred to the Courtor a Judge, and
the Court or Judge shall make such order in the matter asmay
be just.(3)Ifapartysummonedtoattend,beingentitledinprioritytotheapplicant,willnotundertaketomakeapplicationforadministrationforthwith and to
proceed thereon with diligence, the grant may be made totheapplicantasiftheapplicantwereentitledinprioritytothepartysorefusing.˙Summons in other cases46.The
registrar or a Judge may direct the issue of a summons in
anyother case in which it may be necessary or
desirable to hear any party beforemaking a grant of
probate or administration in common form.˙Costs
when action brought47.If on the hearing of the summons an
action is directed to be brought,the costs of and
occasioned by the summons shall be deemed to be costs inthe
action.†5. Sureties˙Security when grant to an authorised
company50.In the case of companies authorised to
obtain grants of administrationand required by
law to invest a specified sum in the name of the Treasurerin
trust for the company, a certificate under the hand of the
Treasurer or theUnder Secretary to the Treasury addressed to
the registrar shall be sufficientevidencethatthesummentionedinthecertificateassoinvestedissoinvested: and any such certificate
shall be received in evidence upon allapplications by
the company for administration until a further certificate
isreceived by the registrar stating that a
different sum is so invested.
381Rules of the Supreme Court†6. Caveats˙Caveats by persons objecting51.(1)Anypersoninterestedwhodesirestoobjectto,ortobeheardupon,anapplicationforagrantofprobateofthewilloragrantofadministration of the lands or goods of a
deceased person, with or withoutthe will, or to
object to a grant of probate or administration with the willbeingmadeexceptuponproofinsolemnformoflaw,mayfileintheregistry a caveat against such
grant.(2)The caveat shall give an address for
service similar to that required tobe endorsed upon
writs of summons in an action.˙Duration of caveat52.Acaveatshallremaininforcefor6monthsonly,butmayberenewed from time to time.˙Caveat book53.Caveatsshallbeenteredinabooktobekeptintheregistry(the“probate and administration caveat
book”).˙Notice to
caveator54.When a caveat has been filed, nothing
shall be done upon a requestforagrantofprobateoradministrationinrespectoftheestateofthedeceasedpersoninrespectofwhichthecaveatwasfiled,whethertherequestispresentedbeforeorafterthefilingofthecaveat,untiltheexpiration of 8 days after notice to
the person by whom the caveat was filed,unless the Court
or a Judge otherwise orders.˙To be
given by registrar—form55.Such notice
shall be given by the registrar to the person by whom thecaveat was filed by post-letter addressed to
the person at his or her addressfor service given
in the caveat, and calling upon the person within 8 days tocause
a memorandum of appearance upon the caveat to be filed, stating
his
382Rules of the Supreme Courtor
her interest in the estate and undertaking to appear to any action
that maybecommencedbytheapplicantforagrantofprobateofthewilloradministration of the estate, as the case may
be.˙Caveator to enter appearance56.(1)Within the said
period of 8 days the person by whom the caveatwasfiledshallcausetobefiledintheregistryamemorandumofappearance upon the caveat, signed personally
or by the person’s solicitor,setting forth the
person’s interest in the estate, and undertaking to enter anappearance in any action that may be
commenced against the person by theapplicant for a
grant of the probate or administration claimed in the
request.(2)If the caveat is filed after the
request has been presented, the personby whom it was
filed may file his or her memorandum of appearance uponthe
caveat concurrently therewith, and without waiting for notice from
theregistrar.˙Default of appearance57.If
such memorandum of appearance is not filed within 8 days
afternotice, the proceedings on the request shall
go on as if a caveat had not beenfiled.˙Action to be brought—service58.(1)Ifsuchmemorandumofappearanceisfiled,nofurtherproceedings shall
be had upon the request unless the caveat is set aside orwithdrawn;buttheapplicantmay,subjecttotheprovisionsoforder7,rule
6, commence an action against the person by whom the caveat
wasfiled, claiming the relief claimed by the
request, or relief of substantially thesame
nature.(2)The writ in such action may be served
at the address for service givenin the
caveat.˙Setting aside caveat59.The Court or a Judge may set aside a
caveat, or an appearance upon a
383Rules of the Supreme Courtcaveat, on the ground that the person by whom
the caveat was filed has nointerest
sufficient to entitle the person to object to the grant applied
for.˙Withdrawal60.A
caveat may be withdrawn by the person by whom it was filed.˙Costs when caveat set aside or
withdrawn61.In either of the cases mentioned in
rules 59 and 60, the Court or aJudge may order
that the costs of the applicant occasioned by the filing ofthe
caveat shall be paid by the person by whom it was filed.˙Caveat on date of grant62.A caveat shall not affect a grant made
on the day on which it is filed,unless the caveat
is brought to the actual knowledge of the registrar beforethe
grant is sealed.˙Costs of action in consequence of
caveat63.(1)When an action
is commenced in consequence of the filing of acaveatthecostsofandoccasionedbythefilingofthecaveatshallbedeemed to be costs in the
action.(2)Exceptasaforesaid,thecontentiousbusinessshallbedeemedtobegin
with the issue of the writ.†7.
Other opposition to grants˙Limited
caveat64.(1)Notwithstandingtheprovisionsoftheprecedingrulesofthisorder,apersonbywhomacaveatisfiledmayintheperson’smemorandum of appearance upon the caveat
state that the person desiresonly to be heard
upon the application for the grant, and that the person doesnot
require the applicant to bring an action.(2)And
in such case the person shall receive 2 days notice of the
hearing
384Rules of the Supreme Courtof
the application, to be served at the person’s address for service
stated inthe caveat.(3)The
person by whom the caveat was filed shall be entitled to be
heardon the application.(4)If
either party requires it, the application shall be heard by the
Courtor a Judge, and in that case the costs shall
be in the discretion of the Courtor Judge.(5)If it appears to the Court or Judge on
the hearing of the applicationthat an action
should be brought, the Court or Judge may direct
accordingly,and in such case the writ of summons may be
served as directed in rule 58.†8.
Sealing probates and letters of administration granted by
BritishCourts˙Application to be made to registrar65.(1)Applications to
seal a grant of probate or letters of administrationor
copy thereof, under theBritish Probates Act 1898,
may be made to theregistrar, who shall have authority to seal
such grant or copy.(2)The application may be made by the
executor or administrator, or apersonlawfullyauthorisedforthepurposebysuchexecutororadministrator, either in person or by
solicitor.(3)A request or other formal written
application is not necessary.˙Notice66.It
shall not be necessary to advertise notice of the application but
inspecial circumstances, the registrar may
require that notice of the applicationbe given by
advertisement in the same manner as prescribed by this order
inthe case of applications for grants of
probate and administration.˙Affidavit by applicant67.(1)Theapplicantmustfileanaffidavitmadebytheexecutororadministratororapersonlawfullyauthorisedbytheexecutororadministrator, or as the case may be, in the
form in schedule 1, with such
385Rules of the Supreme Courtvariations as the circumstances of the case
may require.(2)The affidavit must also set forth a
list of creditors (if any) of the estatein
Queensland.(3)Where the applicant is a person
lawfully authorised by the executor oradministrator the
original certificate or letter of authority addressed to theapplicant by the executor or administrator
authorising the applicant to makesuchapplicationonbehalfofsuchexecutororadministratorshallbeexhibited to the affidavit.˙Caveat of creditor or beneficiary or
next of kin requiring security69.(1)A
creditor, beneficiary, or next of kin, desiring to obtain an
orderfor security under theBritish Probates
Act 1898, section 4(3), may file inthe
registry a caveat against sealing the grant without notice to him
or her.(2)The caveat shall give an address for
service similar to that required tobe endorsed upon
writs of summons in an action.˙Notice
to caveator70.When a caveat has been filed under
rule 69, the grant shall not besealed until the
expiration of 8 days after notice to the person by whom thecaveat was filed, unless the Court or a Judge
otherwise orders.˙Application for security71.The application for an order for
security shall be made to a Judge bysummons,
supported by an affidavit setting out particulars of the
applicant’sclaim or interest.˙Domicile72.When
the domicile of the deceased at the time of death, as sworn
toin the affidavit, differs from that suggested
by the description in the grant,the registrar
shall, and in any other case the registrar may, require
furtherevidence as to domicile.
386Rules of the Supreme Court˙Grant not to be sealed in certain
cases73.If it appears that the deceased was
not at the time of death domiciledwithin the
jurisdiction of the court from which the grant issued, the
sealshall not be affixed to the grant, unless the
grant is such as would have beenmade by the
Supreme Court on application made to that court for a grant
inthe first instance.˙Grant
produced and copies must include all testamentary papers74.The grant or copy grant of probate, or
administration with the will, tobe sealed, and
the copy to be deposited in the registry, must include
copiesof all testamentary papers admitted to
probate.˙Special grants76.Special or limited or temporary grants are
not to be sealed without anorder of a
Judge.˙Notice to court of origin77.Notice of the sealing in Queensland of
a grant shall be sent by theregistrar to the
court from which the grant issued.˙Notice
to courts in which Queensland grants re-sealed78.When
intimation has been received of the re-sealing of a
Queenslandgrant, notice of the revocation of, or any
alteration in, such grant shall besentbytheregistrartothecourtbywhoseauthoritysuchgrantwasre-sealed.˙General rules to apply79.Exceptashereinotherwiseprovided,theprovisionsofthisorderrelating to grants of probate and
administration shall apply to applicationsfor sealing
grants of probate and letters of administration under theBritishProbates Act
1898.
387Rules of the Supreme Court†9. General˙Proof
in solemn form may be made80.Notwithstanding
the foregoing provisions of this order, any executoror
other person entitled to prove a will may prove the same in solemn
formof law.˙Or may
be required81.(1)Anynextofkinorotherpersoninterestedintheestateofadeceased person may require that a will
propounded as his or her last willshall be proved
in solemn form of law.(2)Suchrequirementsshallbemadebycaveatasprovidedbytheserules.(3)The costs occasioned by any such proof
in solemn form shall be inthe discretion of the Court or a
Judge.˙Proof in solemn form after grant in
common form82.(1)When a grant has
been made of probate or of administration withthe will, any
person interested who desires that the will shall be proved
insolemn form of law may apply to the Court or
a Judge, upon notice to theexecutororadministrator,foranorderdirectingtheexecutororadministrator to bring the grant into the
registry.(2)When such order is made, the executor
or administrator shall bring inthe grant
accordingly, and shall forthwith commence an action for
probateof the will in solemn form.(3)The order may include such directions
as to parties to the action, or asto service upon
them, or otherwise, as the Court or Judge may think fit.˙Action for revocation of grant—grant to
be brought in on order83.A person who
desires to bring an action for revocation of a grant ofprobate or administration must before action
apply to the Court or a Judge,uponnoticetotheexecutororadministrator,foranorderdirectingtheexecutor or administrator to bring the
grant into the registry.
388Rules of the Supreme Court˙Revocation of grants without
action—limited grants84.(1)The Court may
revoke a grant of probate or administration uponmotion, without action brought, or may make a
limited grant to such personand on such terms
as it may think fit, in any of the following cases—(a)if it appears that the executor or
administrator is no longer capableof acting in the
administration, or cannot be found;(b)if
the administrator is desirous of retiring from the
administration;(c)if it appears that the grant was made
upon a mistake of fact or oflaw.(2)Upon the hearing of the motion the
Court may direct that an actionshall be brought
for revocation of the grant.˙Grant
to be brought in85.When a grant is revoked without
action, or a limited grant is madeunder rule 84,
the order of revocation, or order directing a limited grant
tobe made, shall direct the executor or
administrator to bring the original grantinto the
registry.˙Retraction of renunciation86.Any person who has renounced the
person’s right, or prior right, to agrant of
administration may, by leave of the Court or a Judge, retract
theperson’s renunciation.˙Application under the Probate Act, s 587.(1)Applications to
the Court under theProbate Act 1867, section
5,in cases where no action is pending, shall be
made to a Judge by summonsin chambers.(2)The
summons shall be entitled, ‘In the matter of A.B., late of,
etc.,deceased’.
389Rules of the Supreme Court˙Witnesses88.When
a request has been filed, applying for a grant of probate oradministration,theapplicantmay,asofcourse,takeoutasubpoenarequiring the
attendance before the registrar of any person as a witness
togive evidence touching any matter necessary
to be proved by the applicantin order to the
obtaining of the grant.˙Copy to be
filed89.Upontheissueofanygrantacopythereofshallbefiledintheregistry.˙Interpretation90.In
this order—“will”includes
“codicil.”†ORDER 72—PROCEEDINGS UNDER THEINTESTACY ACT 1877˙Title
of proceedings1.Proceedings under theIntestacy Act 1877shall be
entitled in the matterof the Act, and shall also be intituled
‘In the lands’, or ‘In the goods’ or ‘Inthe lands and
goods’ of the deceased person in question.˙Applications as to administration2.(1)Applications
under sections 22 and 24 of the Act shall be made byoriginating summons, which shall be served on
such persons as the Courtor a Judge may direct.(2)Whentheapplicationisforanallowanceformaintenanceoradvancement to an infant, the summons must be
entitled in the matter of theinfant as well as
in the manner hereinbefore prescribed.
390Rules of the Supreme Court(3)At the hearing of the summons the
Judge may direct that proceedingsshall be taken by
action.˙Removal of creditor
administrator3.Applications by any person for
administration under section 47 of theAct shall be made
in the manner prescribed by order 71 with respect toapplicationsforgrantsofadministrationincommonform,butshallbeheard
by the Court or a Judge.†ORDER
72A—PROCEEDINGS UNDER THE PUBLICTRUSTEE ACT
1978˙Applications to be made by
request1.(1)Every
application by the Public Trustee for an order to administerwith
the will annexed or in intestacy, shall be by request in writing in
theforminschedule1andshallbesupportedbyanaffidavitintheformapplicable to the
circumstances of the case, sworn by the Public Trustee orLocal
Deputy Public Trustee as the case may be, and by such other
evidenceas the registrar may require.(2)A petition shall not be
necessary.(3)The request need not be served on any
person.˙Revocation of order2.(1)The
Court may, upon motion, without action brought, revoke anorder
to administer granted to the Public Trustee either in intestacy or
withthe will annexed if it appears that the order
was made upon a mistake of factor of law.(1A)Upon the hearing
of the motion the Court may direct that an actionshall
be brought for revocation of the order to administer.(2)ThePublicTrustee,oranypersonwiththeconsentofthePublicTrustee,may,onfilinganaffidavitsettingforththatsuchanorderto
391Rules of the Supreme Courtadminister had been made, the grounds and the
particulars thereof for itsrevocation and,
where necessary, identifying such consent (which in thatevent, must be annexed to the affidavit)
apply to a registrar for an order thatthe said order to
administer be revoked.(2A)The registrar
may revoke the order to administer or may refer anysuch
application or any question arising thereon to a Judge who may
revokethe order to administer or, if the registrar
thinks fit, direct an action to bebrought for the
revocation of the order to administer.(3)If
an order to administer is revoked without action, the duplicate
ofsuch order shall be brought into the registry
by the Public Trustee.†ORDER
73—EXECUTORS’ ADMINISTRATORS’ ANDTRUSTEES’
ACCOUNTS˙Filing and passing account on
application of person interested1.(1)Any
person beneficially interested in an estate and who desires
thatan executor or administrator be called upon
to file and pass an account mayat any time apply
to the Court or a Judge for an order requiring the executoror
administrator to file such account and to proceed to have such
accountexaminedandpassedandinsupportofsuchapplicationshallfileanaffidavit stating the reasons for the
person’s application.(2)Thereupon such
proceedings shall be had and taken as the Court or aJudge
may think fit and the costs of such order and of the proceedings
shallbe in the discretion of the Court or a
Judge.˙Order requiring account2.(1)The executor or
administrator shall within 2 months from the dateofserviceupontheexecutororadministratorofacopyoftheordermentioned in rule
1, file such account and take out an appointment to havethe
account examined and passed and proceed on such appointment.(2)If the executor or administrator fails
to comply with the said orderandthisrule,theCourtoraJudge,ontheapplicationoftheperson
392Rules of the Supreme Courtbeneficially interested may direct such
proceedings to be taken against theexecutor or
administrator as may be thought fit.˙Account3.(1)Wheretheexecutororadministratorproposestoapplyforcommission or if required by order of the
Court or a Judge to have his orher account
examined and passed under the provisions of rules 1 and 2
theaccount shall be a full, true and just
account of his or her administration ofthe estate of the
deceased in the form in schedule 1 verified by the affidavitof
the executor or administrator.(2)Atrusteewhodesirestoobtainanorderfortheallowanceofcommission out of the income or proceeds of
the trust property may causeto be filed in
the registry an account of the trustee’s administration of
thetrust property in the form in schedule 1
verified by the affidavit of suchtrustee and such
executor or administrator or trustee shall proceed to havesuch
account examined and passed and rules 4 to 19 shall apply
thereto.˙Notice4.(1)Notice of the filing of the account of any
executor or administratorortrustee(andofhisorherintentiontoapplyforanallowanceofcommission) and of the day fixed for
examining the same shall be given byadvertisement
published in the manner directed by these rules in the case
ofapplications for probate and letters of
administration.(2)Such notice shall state that any
person having claims on the estate orbeing otherwise
interested therein may inspect the account at the registryand
may before a day specified in the advertisement (and being not
earlierthan30daysafterthelastpublicationoftheadvertisement)fileintheregistry a
memorandum stating that he or she claims to be heard on theexamination and passing of the account, or
allowance of commission.(3)Noticeofthefilingoftheaccountandofthedayfixedfortheexamination thereof and also of the
application to pass the account shall beserved on the
sureties to the bond (if any) unless their consents duly
verifiedare filed.(4)Such
service may be made by forwarding the notice by registeredpost
addressed to the sureties and obtaining from the postal authorities
a
393Rules of the Supreme Courtwrittenreceiptfortheregisteredarticlepurportingtobesignedbytheperson or persons to whom it is
addressed.˙Appearance of person interested5.(1)Any person
having claims on, or being otherwise interested in, theestatemay,beforethedayspecifiedinthenotice,fileintheregistryamemorandum stating that the person
claims to be heard on the examinationand passing of
the account.(2)The memorandum shall state an address
which shall be distant notmorethan10kmfromtheregistry,atwhichallnoticesrelatingtothematter may be
served upon the person on whose behalf the memorandumis
filed.(3)The memorandum shall be accompanied by
an affidavit stating thenature and ground of objection or
exceptions (if any) to such account orallowance of
commission.(4)On the filing of such memorandum such
person shall be entitled toreceive from the
executor or administrator or trustee free of charge a copyof
such account.˙Service6.Theregistrarmaymakesuchorderastoserviceofsuchmemorandum upon
any of the parties interested as the registrar may thinkfit.˙Examination of
account7.Onthedayappointedtheregistrarshallproceedtoexaminetheaccountandshallheartheexecutororadministratorortrusteeandallpersons who have filed a memorandum
under rule 5, and who attend andclaim to be heard
and shall inquire into any objection or exception that maybe
taken to the account or allowance of commission by any such
person.
394Rules of the Supreme Court˙Examination of account,
appearances—proceeding exparte—vouching8.(1)Anypersoninterestedmayattendbeforetheregistrarupontheexaminationofsuchaccount,butshallnotbeentitledtoobjecttothepassing of the account unless the
person has filed a memorandum underrule 5.(2)Ifnopersonfilesamemorandumclaimingtobeheardontheexamination and
passing of the account it may be passed upon the oath ofthe
executor or administrator or trustee alone with the proper
vouchers.(3)Upon the taking of any account the
payments of all sums exceeding$50 shall be
vouched by proper receipts signed by the persons to whom thepayments are alleged to have been made, or in
such manner as the registrarmay deem
satisfactory.(4)However, where the account in question
consists wholly of items ofreceipts and
expenditure paid into and drawn out of the trust account of
adulyqualifiedandpractisingsolicitoronbehalfofanexecutororadministrator or trustee and such trust
account has been duly audited by anaccountantdulyqualifiedwithinthemeaningofthePublic AccountantsRegistrationAct1946(or where such
account is prepared in accordancewith ordinary
accountancy practice and discloses in detail the receipts
anddisbursements and the true position of the
estate accounts), such accountmay be passed on
the production of a certificate by such accountant as to thecorrectness of the vouching thereof without
revouching.(5)The registrar, however, if the
registrar sees fit so to do may requirethe account to be
filed in the manner otherwise prescribed by these rules andthe
registrar may require further revouching of the items referred to
in thesaid account.˙Certificate9.The
result of the registrar’s examination of the account shall be
setforth in a certificate.˙Application to Judge10.(1)When
the certificate has been filed the executor or administrator
or
395Rules of the Supreme Courttrustee shall apply to a Judge by summons for
an order that the account bepassed and may if
the executor, administrator or trustee so desires apply foran
allowance of commission.(2)Notice of the
application shall be given to every person who has fileda
memorandum claiming to be heard on the passing of the account, or
theallowance of commission, and who is not
stated in the certificate to havewithdrawn his or
her objection or exception (if any).˙Power
of Judge11.(1)Upon the hearing
of the application, the Court or a Judge mayrefer the
certificate back to the registrar for review, or may make an
orderthat the account be passed with or without
amendment and may allow thecosts and
expenses of examining and passing the same to the executor
oradministrator or trustee out of the estate
and may make such order as tocommission as may
be just, and may allow the trustee to retain out of theestate the costs and expenses of the
examination and application or maymake such other
order as may be just.(2)The Court or a
Judge may also grant an extension of time for filingand
passing further accounts.˙Costs12.The costs of and occasioned by any
objection or exception shall be inthe discretion of
the Court or a Judge and may be ordered to be paid by orto
the person by whom the objection or exception was made.˙Amended or further account13.TheCourtoraJudgemayatanytimerequireanaccounttobeamended, or a further account or an
amended account to be brought in bythe executor or
administrator or trustee and such proceedings to be takenthereon as may seem fit.˙Renewal of objection in subsequent
action14.When the account has been passed under
this order, and the same
396Rules of the Supreme Courtaccount is afterwards directed to be taken in
an action, a person who, on thetaking of the
account under this order has made an objection or exceptionbefore the registrar, which objection or
exception has been disallowed oroverruled,shallnotbeallowedtorenewtheobjectionorexceptionasagainsttheexecutororadministratorortrusteewithouttheleaveoftheCourt or a Judge.˙Evidence in subsequent action15.(1)When the account
of an executor or administrator or trustee hasbeen passed under
this order, and the same account is afterwards directed tobe
taken in an action, the evidence taken before the registrar on
passing theaccount may, saving all just exceptions, be
read on behalf of the executor oradministrator or
trustee upon the taking of the account in the action.(2)Theorderpassingtheaccountmayalsobereadonbehalfoftheexecutor or administrator or trustee
upon the taking of the account in theaction, and shall
be prima facie evidence on his or her behalf of the factsappearing by the account.˙General practice to apply16.Exceptasotherwiseprovidedbythisorder,theprovisionsoforder
67 relating to proceedings before the registrar in taking accounts
underjudgments and orders shall apply to
proceedings before the registrar underthis
order.˙Combined executors’ and trustees’
account17.(1)Whenthesamepersonisbothexecutorandtrusteeoradministratorandtrusteethepersonmayincludeinthesameaccountastatement of his or her administration
of the property in both capacities, butdistinguishing
the moneys received and disposed of by the person in theseveral capacities.(2)In
any such case the notices by advertisement shall be entitled both
inthe matter of the will, or of the goods, or
land and goods, of the deceasedperson, as the
case may be, and in the matter of the trust; and the
registrar’scertificate shall set forth separately the
result of the registrar’s examinationof the account so
far as it relates to each matter.
397Rules of the Supreme Court˙Allowance of commission in
action18.(1)When a trustee’s
account has been taken in an action the trusteemay apply to the
Court or a Judge for commission at any time after theaccount has been taken.(2)Rules 1 to 17 do not apply to any such
case.˙Powers of taxing officer19.IntheBrisbaneregistry,forthepurposeofthisorder,thetaxingofficer shall
have and be charged with all the powers, authority, and
dutiesof the registrar.†ORDER 74—SUMMARY RELIEF AGAINSTEXECUTORS, ADMINISTRATORS AND TRUSTEES˙Relief in case of neglect or refusal by
executor, administrator ortrustee1.Where an executor or administrator or
trustee, after request in writing,neglects or
refuses to—(a)makeapplicationforandtakeallnecessarystepstohavetransmission of
any real or leasehold estate entered or registered;or(b)where such
executor, administrator or trustee has or is entitled tothe
legal estate in such land—execute a conveyance or transfer
tothe person entitled thereto; or(c)pay or hand over to the person
entitled any legacy or residuarybequest;such
person making such request as aforesaid may apply by summons
foranordercallinguponsuchexecutororadministratorortrusteetoshowcause why the
person should not comply with such request, and thereuponsuch
proceedings shall be had and taken as the Court or a Judge may
thinkfit.
398Rules of the Supreme Court†ORDER 75—PROCEEDINGS UNDER THE
TRUSTEESAND EXECUTORS ACT 1897˙Application, how made1.AnyapplicationundertheTrusteesandExecutorsAct1897may,except as otherwise provided by these rules,
be made by petition, but theCourtmaydisallowanyadditionalcostsoccasionedbyproceedingbypetition instead of summons, and may direct
such costs to be borne andpaid by such persons as may be
just.˙Titles of proceedings2.(1)PetitionsandsummonsesundertheActrelatingtomoneyorsecurities lodged in court under the Act
shall be entitled in the same manneras the authority
under which the lodgment was made.(2)Proceedings under the Act, not being taken
in a pending cause ormatter, shall be entitled in the matter
of the Act, and in the matter of thetrust, described
so as to identify it.˙Sections to be
mentioned in certain cases3.Every petition
or summons under the Act for a vesting order, or forthe
appointment of a person to convey property, shall specify the
section orsections of the Act under which the order is
sought.˙Verification of new trustee’s consent
to act4.(1)The consent of a
new trustee to act shall be sufficiently evidencedby a
written consent signed by the trustee and verified by the signature
ofthe trustee’s solicitor without
affidavit.(2)Theforminschedule1shallbeusedforthatpurpose,withsuchvariations as circumstances may
require.
399Rules of the Supreme Court˙Mode of making payment into
court5.When a trustee desires to pay or
transfer money or securities into courtunder the
provisions of the Act, the trustee shall make and file an
affidavitsetting forth—(a)a
short description of the trust and of the instrument creating
it;(b)particulars of the lodgment intended
to be made;(c)the names of the persons interested in
or entitled to the money,stock, or securities, and their places
of residence, to the best of thetrustee’s
knowledge and belief;(d)the trustee’s
submission to answer all such inquiries relating tothe
application of the money, stock, or securities lodged in
court,as the Court or the Judge may make or
direct;(e)the place where the trustee is to be
served with any proceeding ororder,ornoticeofanyproceeding,relatingtothemoneyorsecurities.˙Notice
of payment6.Thetrusteehavingmadethelodgmentshallforthwithgivenoticethereofbyprepaidletterthroughtheposttotheseveralpersonswhosenamesandplacesofresidencearestatedinthetrustee’saffidavitasinterested in or entitled to the money,
stock, or securities lodged in court.˙Address for service7.Every petition or summons relating to money
or securities paid intocourtundertheActshallbearuponitastatementofaplacewherethepetitioner or applicant may be served with
any proceeding, order, or noticerelating to the
money, stock, or securities, or the dividends thereof.˙Notice of applications8.(1)Noticeofanyapplicationsinrespectofthemoney,stock,orsecurities, so paid into court shall,
unless otherwise directed by the Court ora Judge, be
served on the trustee and on the persons named in the
trustee’saffidavit as interested in or entitled to the
same, and on such other persons
400Rules of the Supreme Courtas
the Court or a Judge may direct.(2)When
a special direction to dispense with service is desired, the
factistobestatedonthepetitionorsummons,andthedirectionmustbeobtained and stated on the petition or
summons before service of it on anyparty.˙Application under s 439.An application under section 43 of the
Act may be made by the trusteeor other person
authorised to dispose of the land in question.˙Application for advice10.(1)An
application for the opinion, advice, or direction of the
Courtunder section 45 of the Act shall be made by
summons.(2)The written statement shall be filed
when the summons is issued.˙Time
for service11.Asummonstakenoutunderrule10mustbeserved7cleardaysbeforethesummonsisreturnable,unlessthepersonservedconsentstoaccept shorter notice.˙Record
of advice etc.12.The opinion, advice, or direction of
the Court shall be drawn up andremain of record
in the same manner as an order made by the Court or aJudge, and shall be termed ‘a judicial
opinion’, or ‘judicial advice’, or ‘ajudicial
direction’, as the case may be.†ORDER 75A—PROVISIONS AS TO ACTIONS INTORT
BETWEEN HUSBAND AND WIFE1.(1)This rule
applies to any action in tort brought by one of the
parties
401Rules of the Supreme Courtto a
marriage against the other during the subsistence of the
marriage.(2)On the first application by motion or
summons in an action to whichthis rule
applies, the Court or a Judge shall consider, if necessary of its
ownmotion,whetherthepowertostaytheactionundertheLawReform(HusbandandWife)Act1968,section2(2)shouldorshouldnotbeexercised(3)Notwithstanding anything in order 15 or 31
judgment in default ofappearance or defence shall not be
entered in an action to which this ruleapplies except
with the leave of a Judge(4)An application
for the grant of leave under subrule (3) must be madebysummonsandthesummonsmust,notwithstandinganythinginorder 93, rule 12, be served on the
defendant personally unless the Court ora Judge otherwise
orders(5)Ifthesummonsisforleavetoenterjudgmentindefaultofappearance, the summons shall not be issued
until after the time limited forappearance.†ORDER 76—INFANTS˙Ward
of court, how constituted1.Aninfantmaybemadeawardofcourtinanyofthefollowingmodes, that is to
say—(a)bythecommencementofanactionfortheadministrationofproperty in which the infant has an
interest, or for the direction ofthe Court with
relation to the estate or person of the infant and forthe
infant’s benefit;(b)by the appointment of a guardian of
the person or estate of theinfant by the
Court or a Judge;(c)by the making of an order by the Court
or a Judge with respect tothe maintenance of the infant;(d)by the payment into court under the
provisions of theTrustees
402Rules of the Supreme Courtand
Executors Act 1897, or in an action, of money or securities
inwhich the infant is interested.˙Title of summons2.(1)An
originating summons for the appointment of a guardian of aninfant, or with respect to the maintenance of
an infant, shall be entitled in thematter of the
infant, naming the infant, and also in the matter of the
statute(if any) under which the application is
made.(2)Whenanapplicationfortheappointmentofaguardianorwithrespect to
maintenance is made in a cause or matter, the summons shall
beentitled in the cause or matter, and also in
the matter of the infant, namingthe
infant.˙Evidence upon applications for
appointment of guardians and formaintenance3.Upon an application for the
appointment of a guardian of an infant, orwith respect to
the maintenance of an infant, the evidence must show theage
of the infant, the nature and amount of the infant’s estate and
income,and what relations the infant has.˙Evidence upon applications for sanction
to settlements of infants onmarriage4.(1)Upon an
application for the sanction of the Court to the settlementof
the property of an infant on marriage under section 151 of
theEquity Act1867,
evidence must be produced showing—(a)the
age of the infant;(b)whether the infant has any parents or
guardians;(c)with whom or under whose care the
infant is living, and, if theinfant has no
parents or guardians, what near relations the infanthas;(d)the
rank and position in life of the infant and parents;(e)what the infant’s estate and income
consist of;
403Rules of the Supreme Court(f)the age, rank and position in life of
the person to whom the infantis about to be
married;(g)what property and income such person
has;(h)the fitness of the proposed trustees,
and their consent to act.(2)Written
proposals for the settlement of the property of the infant
andofthepersontowhomsuchinfantisproposedtobemarried,shallbesubmitted to the Judge.˙Guardians’ accounts5.The
accounts of guardians of infants shall be passed and verified in
thesame manner in which the accounts of
receivers are by these rules directedto be passed and
verified.˙Mode of application under the
Guardianship and Custody of InfantsAct 18916.Applications under theGuardianship and Custody of Infants Act
1891shall be made as follows—(a)if a
cause or matter is pending by reason whereof the infant is award
of court—by a summons in such cause or matter;(b)ifnosuchcauseormatterispending—byanoriginatingsummons.˙Procedure under s 37.A
summons under section 3 of that Act may be taken out by any
nextfriend of the infant, and shall be served
upon the mother of the infant.˙Procedure under s 48.(1)A
summons under section 4(2) of the Act may be taken out by
anynext friend of the infant, and shall be
served upon the father of the infant.(2)A
summons under section 4(3) may be taken out by any guardian
ofthe infant, and shall be served upon the
other guardian or guardians.
404Rules of the Supreme Court˙Procedure under s 69.(1)A
summons under section 6 of the Act taken out by the mother
ofan infant shall be served upon the father of
the infant, or, if the father isdead, upon the
guardian or guardians of the infant (if any) other than themother.(2)A
summons under section 6 of the Act taken out by the father of
aninfant shall be served upon the mother of the
infant, or, if the mother isdead, upon the
guardian or guardians of the infant (if any) other than thefather.(3)A
summons under section 6 of the Act taken out by any guardian
ofan infant, other than a parent, shall be
served upon the other guardian orguardians of the
infant (if any) other than a surviving parent, and also uponthe
surviving parent (if any).˙Procedure under s
710.A summons under section 7 of the Act
may be taken out by any nextfriendoftheinfant,andshallbeserveduponhisorherguardianorguardians.˙Service on other persons11.In
any proceeding under the Act the Judge may direct such
persons,other than those in rules 1 to 10
respectively mentioned, to be served withthe summons as
the Judge may think fit.†ORDER
77—PROCEEDINGS UNDER THE SETTLEDLAND ACT
1886˙Definition1.In
this order—“tenant for life”includes the
tenant for life as defined by the Act, and anyperson having
the powers of a tenant for life under the Act.
405Rules of the Supreme Court˙Title of proceedings2.Proceedings under the Act shall be
entitled in the matter of the Act,and in the matter
of the settlement, described so as to identify it.˙Service3.(1)The
persons to be served in the first instance with a summons
takenout for the purpose of an application under
the Act shall be as follows—(a)inthecaseofapplicationsbythetenantforlifeundersection 20—the trustees;(b)in
the case of applications under section 40—all the tenants
forlife except the applicant;(c)in the case of applications under
section 42—the tenant for life, orthe trustees, as
the case may be;(d)in the case of applications under
section 45 or 61—the trustees (ifany) and the
tenant for life, if he or she is not the applicant.(2)Subject to subrule (1), when an
application under the Act is made byany person other
than the tenant for life, the tenant for life alone shall beserved in the first instance.˙Application by tenant for life4.Except in the cases mentioned in rule
3, upon applications by a tenantfor life the
summons shall not in the first instance be served on any
person.˙Service on other persons5.(1)The Court or
Judge may require notice of any application under theAct
to be served upon such persons as the Court or Judge may think fit,
andmay give all necessary directions as to the
persons (if any) to be served; andsuch directions
may be added to or varied from time to time as the casemay
require.(2)If the application is made by
petition, the petitioner may, after thepetition has been
presented, apply to a Judge for directions with regard tothe
persons on whom the petition is to be served.
406Rules of the Supreme Court(3)If any person not already served is
directed to be served with noticeofanapplication,theapplicationshallstandovergenerally,orforsuchperiod as the
Court or Judge may direct.(4)The Court or
Judge may, in any particular case, upon such terms (ifany)
as the Court or Judge think fit, dispense with service upon any
personuponwhom,undertheserules,orunderanydirectionoftheCourtorJudge, notice of any application is to be
served.˙Evidence6.The
title of the tenant for life and trustees or other persons
interested intheapplicationmaybeprovedbyaffidavit,withoutproductionoftheoriginal settlement, unless the Court
or Judge in any particular case requiresfurther
evidence.˙Sales7.AsaleauthorisedordirectedbytheCourtundertheActshallbecarried into effect out of Court unless
the Court or Judge otherwise directs,and generally in
such manner as the Court or Judge may direct.˙Leases
and grants8.When a lease is authorised under
section 20 of the Act, the order mayeither approve a
lease or conveyance already prepared, or may direct that thelease
or conveyance shall contain conditions specified in the order, or
suchconditions as may be approved by the Judge at
chambers, without directingthe lease or
conveyance to be settled by the Judge.˙Payment of capital money into court9.Any person directed by the tenant for
life under section 31 of the Actto pay into court
any capital money arising under the Act may pay the sameinto
court, without any order, in the manner directed by order 75, rule
5.
407Rules of the Supreme Court˙Form of order10.(1)When
money is paid into court under section 31 of the Act, theCourt
may direct the investment of the money on any securities
authorisedby section 30(a) of the Act, and the payment
of the dividends to the tenantfor life, either
forthwith or upon production of the consent in writing of
thetrustees, the signature to which consent must
be verified by the affidavit of asolicitor.(2)But, if the transaction in respect of
which the money arises is notcompleted at the
date of payment into court, the money shall not, withoutthe
consent of the trustees, be ordered to be invested in any
securities otherthan those upon which cash under the control
of the Court may be invested.˙Title
of account11.Money paid into court under the Act
shall be paid to an account to beentitledinthematteroftheActandofthesettlement,withashortdescriptionofthemodeinwhichthemoneyarisesifitisnecessaryordesirable to identify it.˙Costs
of payment into court12.Any person
paying into court any capital money arising under theAct
shall be entitled first to deduct the costs of paying the money
into court,which may be taxed by the taxing officer
without any other authority thanthis rule.†ORDER 78—ARREST OF ABSCONDINGDEFENDANTS˙Form
of writ of capias ad respondendum1.(1)A
writ of capias against a defendant directed to be held to bail in
anactionshallbeintheforminschedule1,andshallhaveuponitthememoranda in that form set
forth.
408Rules of the Supreme Court(2)It shall be endorsed with a statement
of the amount for which thedefendant is to
be held to bail, and of the name of the Judge by whom theorder
to hold to bail was made, and the date of the order.(3)It shall also be endorsed with a
statement of the plaintiff’s address,andaddressforservice,andthenameandaddressforserviceoftheplaintiff’s solicitor, if the plaintiff
sues by solicitor, in the same form as isprescribed in the
case of writs of summons.˙Effect of
noncompliance2.Iftheprovisionsofrule1arenotcompliedwith,thewritandallproceedings taken under it may be set
aside by the Court or a Judge, and thebailbondhereinaftermentionedmaybeorderedtobecancelled,orthedeposit may be ordered to be
returned.˙Misdescription of defendant3.If the defendant is described in the
writ of capias or affidavit to hold tobailbyinitialsorbyawrongname,orwithoutachristianname,thedefendant shall not for that reason
only be entitled to be discharged fromcustody, or to
have the bail bond delivered up to be cancelled, or the
depositreturned.˙Writ
to be executed within 2 months4.(1)The
writ of capias must be executed within 2 months from the
datethereof, including the day of such date, or
within such longer or shorterperiod as may be
specially directed by the order to hold to bail.(2)The sheriff or other officer to whom
the writ of capias is directedmaydeliverthedefendanttothesuperintendentofanyprisonandsuchsuperintendent
shall receive the said defendant and the defendant safely
keepin the said prison until such time as the
Court or the sheriff or other officershall
direct.˙Service of writ5.The
writ of summons in the action shall be served upon the
defendant
409Rules of the Supreme Courtat
the time of the arrest; otherwise the arrest and all proceedings
thereonmay be set aside by the Court or a Judge, and
the bail bond may be orderedto be delivered
up to be cancelled, or the deposit may be ordered to bereturned.˙Bail
bond6.When the defendant upon the
defendant’s arrest gives a bail bond tothe sheriff or
other officer to whom the writ of capias is directed, the
bondshall be in a sum not exceeding double the
amount of the sum for which thedefendantisorderedtobeheldtobail,exclusiveofcosts,andshallbeconditionedthatthedefendantshall,withinthetimeallowedforthedefendant’s
appearance to the writ of summons, either render himself orherself to the sheriff or such other officer,
or put in and perfect special bailin the action in
manner hereinafter directed.˙Deposit to be paid into court7.When the defendant on the defendant’s
arrest, instead of giving a bailbond, makes
deposit with the sheriff or other officer of the sum for
whichthe defendant is ordered to be held to bail,
with £10 ($20) for costs, thesheriff or such
other officer shall forthwith pay the same into court to thecredit of the action to abide the order of
the Court, and shall give notice ofsuch payment to
the plaintiff.˙Endorsement of execution8.The person by whom a writ of capias is
executed shall within 6 daysafter the
execution thereof endorse on the writ the day of the month
andweek of the execution thereof.˙Default of defendant in perfecting
bail9.If the defendant makes default in
performing the conditions of the bailbond, the
plaintiff may by notice signed by the plaintiff’s solicitor, if
theplaintiffsuesbysolicitor,orpersonallyiftheplaintiffsuesinperson,require the
sheriff or other officer to whom the writ of capias is directed,
to
410Rules of the Supreme Courtretake the defendant within a time specified
in the notice, and not being lessthan 8
days.˙Duty of sheriff10.(1)Upon
such notice being given it shall be the duty of the sheriff
orsuch other officer to retake the defendant
and retain the defendant as of hisor her former
custody.(2)The sheriff or other officer may
exercise this power whether the writof capias has or
has not been returned.˙Sureties may
require defendant to be rearrested11.(1)At
any time before special bail has been perfected, the sureties
tothe bail bond, or either of them, may apply
to a Judge ex parte for andobtain an order
that the defendant be retaken by the sheriff or such otherofficer as aforesaid.(2)When
such an order has been made, any such surety may personallyretake the defendant and render the defendant
to the sheriff or such otherofficer.(3)Upon such order being made the
sureties to the bail bond shall beexonerated.˙Assignment of bail bond to plaintiff12.Theplaintiff,insteadofgivingnoticetoretakethedefendantasprovidedbyrule9,maybylikenoticerequirethesherifforsuchotherofficer to assign the bail bond to the
plaintiff, and the sheriff or other officershall thereupon
assign the same to the plaintiff by instrument under his orher
hand and seal, and the plaintiff may sue thereon in the plaintiff’s
ownname.˙Attachment of sheriff13.(1)If
the sheriff or other officer makes default in compliance with
anotice or order under rule 9 or 11, the
sheriff or other officer shall be liableto attachment as
for disobedience to an order of the Court.
411Rules of the Supreme Court(2)ButtheCourtoraJudgemayextendthetimeforretakingthedefendant.˙Special bail, how given14.(1)Special bail shall be given by giving
security in the action in themanner in which
security is required to be given in actions, and shall bedeemed to be perfected when the security is
filed.(2)Theconditionofthesecurityshallbethat,ifjudgmentisgivenagainst the
defendant in the action, the defendant shall satisfy the
judgmentand costs, or render himself or herself to
the sheriff under a writ of capiasadsatisfaciendum,andthat,indefaultofthedefendantsomakingsatisfactionorrenderinghimselforherself,thesuretieswillmakesatisfaction of
the judgment and costs.˙Number of
sureties15.(1)Except by
consent, 2 sureties shall be required to the security, eachofwhomshallbeboundinthefullamountforwhichthedefendantisordered to be held to bail, and £10 ($20) for
costs.(2)The Court or a Judge may allow
security to be given by a greaternumber of
sureties than 2, so that the sum of the amounts for which
thesureties are severally bound is not less than
double the amount for whichthe defendant is
ordered to be held to bail.˙Security of certain persons to be
ineffectual16.If a surety, although the surety has
been approved, is a practisingsolicitor or
clerk to a practising solicitor, or a sheriff’s officer, bailiff,
orperson concerned in the execution of process
of any Court, the plaintiff maytreat the bail as
a nullity.˙Effect of assignment of bail
bond17.Whenthebailbondhasbeenassignedtotheplaintiff,nofurtherproceedings shall
be taken for the purpose of putting in or perfecting specialbail
in the action.
412Rules of the Supreme Court˙Discharge of defendant in special
bail18.As soon as special bail is perfected,
the defendant, if in custody, shallbe entitled to be
discharged, and no further proceedings shall be taken on thebail
bond, whether it has been assigned to the plaintiff or not.˙Deposit may be applied in lieu of
special bail19.If the defendant on the defendant’s
arrest has made a deposit insteadof giving a bail
bond, the defendant may give notice to the plaintiff, signedpersonally,orbythedefendant’ssolicitor,ifthedefendantappearsbysolicitor, that the money deposited is
to be applied in lieu of special bail; andthereupon the
same consequences shall ensue as if special bail had been
putin and perfected.˙Render
of defendant20.(1)After special
bail has been given the Court or a Judge may, on theapplication of the defendant, or the
defendant’s sureties, or either of them,make an order
that the defendant be rendered to a prison to be specified
inthe order, and such order shall be a
sufficient warrant to the sureties, oreither of them,
to take the defendant, and render the defendant to the
prisonspecified, and to the superintendent of the
prison to receive and detain thedefendant, and to
the sheriff to detain the defendant.(2)Upontherenderofthedefendanttoprisoninpursuanceofsuchorder, an office
copy of the order, together with a notice in writing, signedby
the defendant or his or her sureties, or 1 of them, or his, her or
theirsolicitor, shall be delivered to the sheriff,
and also to the plaintiff, or theplaintiff’s
solicitor, and thereupon the sureties shall be exonerated from
theirobligation under the security.˙If defendant already in custody21.If the defendant is already in custody
under the judgment of any courtor by virtue of
any process issued out of any court, a like order may bemade,andthesame,togetherwithalikenotice,shallbeservedinlikemanner; and the
order shall operate as a sufficient warrant to the sheriff
andthe superintendent of the prison to detain
the defendant, and the suretiesshall be
exonerated in like manner.
413Rules of the Supreme Court˙Speedy trial22.(1)When
the defendant is in custody under a writ of capias or underan
order for rendering or detaining the defendant as hereinbefore
provided,the plaintiff shall give notice of trial for
a time not later than the first sittingsfor which notice
of trial can be given, unless the Court or a Judge otherwiseorders.(2)If
the plaintiff fails to give such notice, the defendant shall be
entitledto be discharged from custody under the
capias or such order as aforesaid.˙Writ
of capias ad satisfaciendum23.(1)Before enforcing
the special bail against the sureties the plaintiffshall
issue a writ of capiasad satisfaciendumagainst the
defendant, andshall procure the same to be returned.(2)Such writ shall be issued within 1
month after the date of judgment,and the time for
the return of the writ shall be 8 days after the date of theissue
thereof.˙Liability of sureties24.Thesuretiesshallnotbeliableforanygreatersumthanthatforwhich the defendant is ordered to be
held to bail, and £10 ($20) for costs,nor shall they
collectively be liable for a greater sum than that specified
inthe security.˙Discharge of sureties25.If
the plaintiff discontinues the plaintiff’s action, or judgment is
givenfor the defendant, or the action is otherwise
determined in his or her favour,the liability of
the sureties shall be determined, and the deposit (if any)
shallbe ordered to be returned to the
defendant.
414Rules of the Supreme Court†ORDER 79—FOREIGN ATTACHMENT˙Form of writ1.(1)A
writ of foreign attachment under the provisions of theCommonLaw Process Act
1867shall be in the form in schedule 1.(2)The time limited for the appearance of
the garnishee shall be the sameas if the writ
were a writ of summons in an action against the garnishee,except that it shall in no case be less than
14 days.˙Entry of appearance not required2.The garnishee shall not be required to
enter an appearance to the writof foreign
attachment.˙Time for examination of
garnishee3.(1)The plaintiff
shall deliver to the sheriff for service on the garnisheea
notice, signed by the plaintiff or the plaintiff’s solicitor, if
the plaintiff suesby solicitor, requiring the garnishee to
attend on a day to be named in thenotice, and not
being earlier than the time limited by the writ for
appearance,at a specified hour before the Judge sitting
in chambers, to be examinedtouching the
property referred to in the writ.(2)The
date for such attendance may be left blank in the notice when it
isdelivered to the sheriff, but shall, before
service of the notice, be writtentherein by the
sheriff or the sheriff’s officer.(3)Any
day on which a Judge sits in chambers may be so inserted in
thenotice.(4)The
notice shall be served with the writ or within 7 days
afterwards.˙Default of attendance4.If the garnishee fails to attend at
the Judge’s chambers on the day andatthehoursoappointed,thelikeproceedingsmaybetakenagainstthegarnishee as if the garnishee had
disobeyed a subpoena to attend at the sametime and
place.
415Rules of the Supreme Court˙Inquiry to be ex parte5.The inquiry into the several matters
specified in section 36 of the Actshall be made ex
parte.˙Service of proceedings on
defendant6.For the purpose of proceedings in the
action the address for service ofthedefendantshallbedeemedtobetheregistry,andallproceedingsrequired to be
served on a defendant shall be served by sticking them up inthe
public office of the registry.˙Proceedings to be taken on notice7.All proceedings of which the defendant
would be entitled to notice ifthe defendant had
appeared to the action shall be taken upon notice served atthe
defendant’s address for service in manner aforesaid.†ORDER 80—PROCEEDINGS RELATING
TOMENTALLY ILL PERSONS˙Title
of proceedings1.(1)ProceedingsintheCourtintheexerciseofitsjurisdictionwithrespect to the person or estate of mentally
ill persons, shall be entitled in thematter of the
person in question, naming the person by his or her name atlength, and describing the person as a
mentally ill person.(2)If the person has not been declared to
be mentally ill by a judicialproceeding, the
words ‘not so declared’ shall be added, unless the person isa
patient in a hospital for mentally ill persons under the laws
relating to suchpersons, in which case the words ‘a patient’
shall be added.˙Proceedings in chambers2.(1)Any application
with respect to the person or estate of a person whois
mentally ill may be heard and determined by a Judge in chambers,
except
416Rules of the Supreme Courtwhen
by law or by these rules it is required to be made by petition, or
to beheard and determined in court.(2)But the Judge may require any matter
to be brought on by motion orpetition.˙Original proceedings for declaration
that a person is mentally ill3.(1)An
application for a declaration that a person is mentally ill,
andincapableofmanaginghisorherestate,orforanorderauthorisingtheremoval of a person who is mentally ill out
of Queensland shall be made bypetition.(2)Every such petition shall set forth
the interest of the petitioner in thematter and shall
be signed by the petitioner and attested by a solicitor orcommissioner for taking affidavits or a
justice of the peace.˙Service4.(1)The petition
shall, unless the Court or a Judge otherwise orders, beserved on the person alleged to be mentally
ill; and shall be served by beingdeliveredtothepersonpersonally,or,ifitisfoundimpracticableorinexpedient to serve the person personally,
by being delivered to some adultinmate of the
dwelling house or usual or last known place of abode withinthe
jurisdiction of the person to be served.(2)A
copy of the petition and of any supporting affidavit shall be
servedon the Public Trustee and on such other
persons as the Court may direct.(3)A
notice in the form in schedule 1 shall be endorsed on the
copypetition served.(4)Anaffidavitofservice,which,ifpersonalservicehasnotbeeneffected, shall set forth the grounds why
such service was impracticable orinexpedient,
shall be filed forthwith after service.˙Request for jury5.(1)An
application that the question whether a person is mentally ill
andincapable of managing his or her estate shall
be tried by a jury may be madeby the person
personally, or by the petitioner, or by any person who
would
417Rules of the Supreme Courtbecompetenttopresentalikepetitionagainstthepersonallegedtobementally ill, and
may be made at any time before the time appointed fortrying the question, or at the time so
appointed.(2)A request for a jury, in the form in
schedule 1, shall be filed, andshall be served
on the Public Trustee; and, if the request is not made by
thepetitioner, shall be served on him or her
also.˙Discharge of persons alleged to be
mentally ill6.(1)An application
for an order for the discharge from custody of aperson detained as mentally ill shall be made
in the first instance to a Judgeex parte.(2)And the Judge may thereupon make an
order calling on the personhaving the
custody of the person in question to show case why the
lattershould not be discharged from such
custody.˙Party becoming mentally ill7.Where, after any cause or matter has
begun, a party to the cause ormatter becomes a
mentally ill person, his or her solicitor shall forthwithnotify all other parties to the cause or
matter, and an application shall bemade for the
appointment of a person to be the next friend or guardianadlitemof that
party.†ORDER 81—RULES OF COURT RELATING
TOAPPLICATIONS FOR JUDICIAL REVIEW˙Interpretation1.(1)In
this order—“Act”means theJudicial Review Act 1991.“reviewapplication”meansanapplicationstartedorcontinuedinaccordance with rule 2, 3, 4 or
5.
418Rules of the Supreme Court(2)In this order, a reference to a form
by number is a reference to theform so numbered
in schedule 1.˙Form of application for statutory order
of review2.(1)An application
for a statutory order of review under the Act mustbe
made in, or substantially in, form 465.(2)If
the grounds of the application include an allegation of fraud or
badfaith, the applicant must set out in the
application particulars of the fraud orbad faith on
which the applicant relies.˙Form
of application for review3.(1)Anapplicationforreviewundersection43oftheActmustbemade
in, or substantially in, form 466.(2)If
the grounds of the application include an allegation of fraud or
badfaith, the applicant must set out in the
application particulars of the fraud orbad faith on
which the applicant relies.˙Application for statutory order of review and
for review4.If—(a)an
application for a statutory order of review under the Act;
and(b)an application for any relief
mentioned in section 43 of the Act;relate to the
same matter—(c)the applications may be made in the
one application; and(d)that application
must, with all necessary adaptations, be made in,or
substantially in, form 465.˙Relief
based on application for review if application made forstatutory order of review5.If—(a)anapplicationismadeforastatutoryorderofreviewinaccordance with rule 2 or 3 in relation
to—
419Rules of the Supreme Court(i)a decision; or(ii)conduct engaged in, or proposed to be
engaged in, for thepurpose of making a decision; or(iii)a failure to
make a decision; and(b)the Court
considers—(i)that the decision to which the
application relates does not fallwithin the
definition “decision to which this Act applies” insection 4 of the Act; and(ii)that any relief
or remedy mentioned in section 43 of the Actmay have been
granted in relation to the decision, conduct orfailure if it
had been sought in an application for review atthe time of
starting the application for a statutory order ofreview;the Court may,
instead of refusing the application, order the proceeding tocontinue as if it had been started as an
application for review at that time.˙Related damages claim6.A
cause of action for damages that relates to the same matter as
areview application may be pleaded in, or
joined with, the review application.˙Filing
documents7.Onthefilingofareviewapplication,orassoonafterwardsasispracticable,theapplicantmustfilecopiesofsuchofthefollowingdocumentsasareintheapplicant’spossessionunlessacopyofthedocument has been filed previously in
the proceeding—(a)a statement of the terms of the
decision to which the applicationrelates;(b)either—(i)a
statement relating to the decision given to the applicantunder section 33 of the Act; or(ii)any other
statement given by or on behalf of the person whomade
the decision purporting to set out—
420Rules of the Supreme Court(A)findings of fact; and(B)a reference to the evidence or other
material on whichthe findings were based; and(C)the reasons for making the
decision.˙Fixing of directions hearing8.On the filing of a review application,
the registrar must fix a time, dateand place for a
directions hearing before the Court (constituted by a Judgeor
Master).˙Service on other parties9.The applicant must serve—(a)a copy of the review application;
and(b)notice of the time, date and place of
the directions hearing; and(c)a
copy of all statements filed under rule 7;on the other
parties to the proceeding at least 14 days before the
directionshearing, unless the time for service is
abridged by the Court.˙Orders and
directions at directions hearing10.(1)At
the directions hearing, the Court (constituted by a Judge orMaster)maymakesuchordersandgivesuchdirectionsrelatingtotheconduct of the
proceeding as it considers appropriate.(2)Withoutlimitingsubrule(1),theCourtmaymakeordersrelatingto—(a)discovery and inspection of documents;
and(b)interrogatories; and(c)inspections of real or personal
property; and(d)admissions of fact or of documents;
and(e)the defining of the issues by
pleadings or otherwise; and(f)the
standing of affidavits as pleadings; and
421Rules of the Supreme Court(g)the joinder of parties; and(h)the method and sufficiency of service;
and(i)amendments; and(j)theinterlocutorystepsappropriatetoacauseofactionindamages, pleaded or joined under rule 6;
and(k)the filing of affidavits; and(l)the giving of particulars; and(m)theplace,timeandmethodofhearing(includingwhetherthehearingistotakeplacebeforeasinglejudgeoftheCourtorbefore the Court of Appeal);
and(n)the giving of evidence at the hearing
(including whether evidenceof witnesses in
chief is to be given orally or by affidavit, or both);and(o)the disclosure
of reports of experts; and(p)costs;
and(q)thefilingandexchangeofsignedstatementsofevidenceofintended witnesses and their use in evidence
at the hearing.(3)Without limiting subrule (1), the
Court may—(a)order that evidence of a particular
fact be given at the hearing—(i)by
statement on oath on information and belief; or(ii)by
production of documents or entries in books; or(iii)by
copies of documents or entries; or(iv)by
an agreed statement of facts; or(v)otherwise as the Court directs; and(b)orderthatanagreedbundleofdocumentsbepreparedbytheparties; and(c)order that no more than a specified number
of expert witnessesmay be called; and(d)order that the reports of experts be
exchanged; and(e)orderthatapartyserveacopyoftheapplicationonthe
422Rules of the Supreme CourtAttorney-General; and(f)order that a party give notice of the
application to such persons orclasses of
persons, and in such way, as the Court directs; and(g)exercise any of the discretions
conferred by part 1, division 3 orsection 48 of
the Act to stay or dismiss an application; and(h)fix
a date for a further directions hearing; and(i)fix
a date for hearing; and(j)fix a date after
which the parties are directed to arrange with theregistrar a date for hearing.(4)The Court may revoke or vary an order
made under subrule (1), (2)or (3).˙Hearing and determination of
application at directions hearing ifparties
agree11.TheCourtmayhearanddeterminethereviewapplicationonadirections hearing if the parties
agree.˙Non-appearance of parties at directions
hearing12.(1)If no applicant
appears before the Court on a directions hearing,the
Court may—(a)dismiss the review application;
or(b)make any other order it considers
appropriate.(2)If no respondent appears before the
Court on a directions hearing, theCourt may give
such directions as it considers appropriate.˙Motion
for dismissal or stay at directions hearing13.(1)A
party may move the Court for an order under section 10 or 42of
the Act at a directions hearing if notice of the motion is served
on theother parties to the proceeding not less than
3 days before the directionshearing.
423Rules of the Supreme Court(2)The Court may abridge the time for
service, or dispense with service,under subrule
(1).˙Motion for dismissal to be made
promptly14.A party who seeks to have a review
application dismissed—(a)on a ground set
out in part 1, division 3 or section 48 of the Act;or(b)in the exercise
of the Court’s discretion;must apply promptly for the
dismissal.˙Motion for costs order at directions
hearing15.An applicant may move the Court for an
order under section 49 ofthe Act at a directions hearing if
notice of the motion is served on the otherparties to the
proceeding not less than 3 days before the directions
hearing.˙Interlocutory orders or directions to
be sought at directions hearing16.On a
directions hearing, each party must, so far as practicable,
applyfor any interlocutory order or direction that
the party requires.˙Motion for interlocutory order or
direction otherwise than atdirections hearing17.A
party may move on notice for an interlocutory order or
directionnot made at a directions hearing.˙Noncompliance with interlocutory
order18.(1)If a party fails
to comply with an order of the Court directing theparty
to take a step in the proceeding, another party may move the Court
onnotice—(a)ifthepartyindefaultisanapplicant—foranorderthattheproceeding be stayed or dismissed as
to the whole or a part of therelief claimed
by the applicant in the proceeding; or
424Rules of the Supreme Court(b)if the party in default is a
respondent—for judgment or an orderagainst the
respondent; or(c)for an order that the step in the
proceeding be taken within thetime specified
in the order.(2)The Court may—(a)make
an order of the kind mentioned in subrule (1); or(b)make another order; or(c)givesuchdirections,andspecifysuchconsequencesfornoncompliance with the order, as the Court
considers appropriate.(3)ThisruledoesnotlimitthepoweroftheCourttopunishforcontempt.˙Additional requirements for order of
certiorari19.An order of certiorari may be granted
only if—(a)acopyoftheorder,warrant,conviction,inquisitionorrecordrelevant to the
proceeding, verified by an affidavit, has been filed;or(b)the failure of
the applicant to file the copy is accounted for to thesatisfaction of the Court.˙No action in relation to things done
under mandamus order20.Noactionorproceedingmaybebegunorprosecutedagainstaperson in relation to anything done in
obedience to an order of the Court forrelief in the
nature of mandamus.˙Consolidation of actions for
prerogative injunctions21.If there is more
than 1 application for an injunction under section 42of
the Act pending against several persons in relation to the same
office andonthesamegrounds,theCourtmayordertheapplicationstobeconsolidated.
425Rules of the Supreme Court˙Proceedings in relation to statements
of reasons22.(1)An application
to the Court for a declaration or order under part 4of
the Act must be made in, or substantially in, form 467.(2)On the filing of an application under
subrule (1), the applicant mustfile an affidavit
containing—(a)the applicant’s name and description;
and(b)details of the relief sought and the
grounds on which it is sought;and(c)the facts relied on.(3)On the filing of an application under
subrule (1), the registrar mustfixatime,dateandplaceforadirectionshearingbeforetheCourt(constituted by a
Judge, Master or registrar), not earlier than 14, and notlaterthan21,daysafterthefilingoftheapplication,unlessthetimeisabridged by the Court.(4)The
applicant must serve the application and the affidavit
mentionedin subrule (2) on the respondent at least 7
days before the directions hearing,unless the time
for service is abridged by the Court.(5)At a
directions hearing, the Court may make such orders and givesuchdirectionsrelatingtotheconductoftheproceedingasitconsidersappropriate
(including such of the orders and directions set out in rule 10
asmay be appropriate to the proceeding).(6)Theprovisionsofrules11and16to18apply,withnecessarymodifications, to
an application made to the Court under subrule (1).˙Use of affidavits23.Despite order 41, rule 27, the Court
may—(a)dispense with the attendance for
cross-examination of a personmaking an
affidavit; and(b)may direct that an affidavit be used
without the person making theaffidavit being
cross-examined in relation to the affidavit.
426Rules of the Supreme Court˙Application by unincorporated
body24.(1)If the applicant
in an application made to the Court under the Actis an
unincorporated body, the application may be brought in the name
ofthe body.(2)Subrule (1) does not apply unless, at the
time of filing the application,there is also
filed an affidavit sworn by an officer of the body deposing
tothe names and addresses of all members of the
body.(3)The affidavit must be served on each
party to the proceeding.˙Joining of action
for declaration or injunction25.An
action for a declaration or injunction started by writ of
summonsororiginatingsummonsthatrelatestothesamematterasareviewapplication may
be joined with the review application.†ORDER 82—HABEAS CORPUS˙How
applied for1.(1)Applicationsforwritsofhabeascorpusorforordersfortheproduction of
persons in confinement for the purpose of examination ortrial, may be made to the Court or a Judge ex
parte.(2)The affidavits upon which the
application is made shall be entitled ‘Inthe Supreme Court
of Queensland’ without other title, except in the case ofapplications for orders to produce persons
for examination as witnesses incauses or matters
pending in the Court, in which case they shall also beentitled in the cause or matter.˙How granted2.(1)The
Court or Judge may make an order absolute in the first
instancefor the issue of the writ or production of
the person, or may make an ordercalling upon the
person who would be required to obey the writ or order, ifgranted, to show cause why it should not be
issued or made.
427Rules of the Supreme Court(2)Theorderandallsubsequentproceedingsshallbeentitled‘TheQueen
against’ the person to whom the writ or order is directed.˙Service3.(1)Writsofhabeascorpus,andordersforproductiondirectedtopersons charged by law with the custody
of persons in lawful custody orconfinement, may
be served either personally or by leaving the original witha
servant or officer of the person to whom the writ or order is
directed at theplace where the person in question is
confined or detained.(2)Other writs of
habeas corpus must be served personally.(3)When
a writ of habeas corpus is directed to more persons than 1,
itshallbeservedinthesamemannerasawritofmandamusdirectedtoseveral persons.(4)Together with the writ there shall be served
a notice, directed to theperson to whom the writ is addressed,
and pointing out the acts to be doneby the person in
obedience to the writ, and the consequences of makingdefault.˙Returns to writs of habeas corpus4.(1)The person to
whom a writ of habeas corpus is directed shall, at thetime
and place specified therein, make the person’s return to the writ,
whichshallbeendorseduponorattachedtothewrit,andshallsetoutallthecauses of the detention of the person named
in the writ.(2)The return shall be filed.˙Amendment of return5.The
return may be amended by leave of the Court or a Judge.˙Proceedings on return6.Upon the return of the writ the return
shall be read, and a motion shallthenbemadeforthedispositionofthepersonthereinnamed,orforamending or quashing the
return.
428Rules of the Supreme Court˙Order of speeches7.Upon
a motion for the discharge of the person in custody, the
personor the person’s counsel shall first be heard,
then the person denying his orher right to be
discharged, or the person’s counsel, and then the first
namedperson, or 1 of his or her counsel, in
reply.˙Discharge without writ8.When an order to show cause has been
made, the Court or Judge may,on the return of
the order, direct the discharge or other disposition of theperson in question without the issue of a
writ of habeas corpus, and anysuch order shall
be as effectual as if it had been made on the return of a
writ.†ORDER 83—ESCHEAT˙Direction of writ1.AwritofinquisitionissuedundertheEscheat(ProcedureandAmendment) Act 1891shall,unlessotherwiseorderedbytheCourtoraJudge, be addressed to the District
Court Judge to whom the district withinwhich the land
with respect to which the inquiry is to be made is situated
isassigned.˙Jury2.(1)When a writ of
inquisition is addressed to a District Court Judge,the
questions of fact arising on the inquiry shall, unless otherwise
orderedbytheSupremeCourtoraJudgethereof,bedeterminedbyajuryof4
persons, who shall be chosen and impanelled from the panel of
jurorssummoned for the trial of civil actions at
the sittings of the court at whichthe inquiry is to
be made.(2)The Judge shall administer or cause to
be administered to the jurorsan oath to
inquire into the matter, and give a true verdict according to
theevidence.
429Rules of the Supreme Court(3)The laws relating to jurors summoned
for the trial of civil actions inDistrict Courts
shall apply to such juries and jurors.˙Notice
of inquiry3.The time for holding the inquiry shall
be appointed by the DistrictCourt Judge or
other person to whom the writ is addressed, and shall benotifiedtwiceatleastbypublicadvertisementinsomenewspapercirculating in the district and published not
less than 16 days before the timeso
appointed.˙Time for holding inquiry4.(1)If the writ is
addressed to a District Court Judge, the inquiry shallbe
held at a time appointed for holding sittings of the District Court
of thedistrict within which the land in question is
situated.(2)In any other case, the inquiry shall
be held at a convenient place to beappointed by the
person to whom the writ is directed, and to be notified inthe
advertisement.˙Inquiry to be in open court5.The inquiry shall be held in open
court, and may be adjourned fromtime to
time.˙Witnesses6.Theattendanceofwitnessesmaybeenforcedbysubpoenaissuedfrom
the registry.˙Parties7.Any
person who shall offer himself or herself may give evidence
onthe inquiry; and any person claiming or
setting up any title to the land inquestion may be
heard, and may cross-examine any witness personally orby
the person’s counsel or solicitor.
430Rules of the Supreme Court˙Discharge of jury8.When
there is a jury, the District Court Judge may discharge the
juryunder any such circumstances as would warrant
the discharge of a jury in acivil action, and
thereupon a fresh jury shall be impanelled at the same orsome
later sittings of the court.˙Certificate of result of inquiry9.The result of the inquiry shall be set
forth in a certificate in writing orprint, under the
hand and seal of the District Court Judge, or other personholding the inquiry.˙Form
of certificate10.Thecertificateshallcertifythefactsfoundwithrespecttoeverymaterial matter
specified in the writ of inquisition.˙To be
endorsed on or annexed to writ11.Thecertificateshallbeendorseduponorannexedtothewritofinquisition, and shall be forthwith returned
into the registry and filed.˙Writ
of further inquiry12.A writ of further inquiry upon the
same writ of inquisition, as to thewhole or any part
of the matters specified therein, may be awarded fromtime
to time on the fiat of a Crown Law Officer, or by order of the
Court ora Judge.˙Proceedings on writ of further inquiry13.(1)When a writ of
further inquiry is issued, the inquiry shall be heldde
novo, except so far as otherwise directed by the fiat or
order.(2)The proceedings on the writ of further
inquiry shall be the same, withthe necessary
variations, as on a first inquiry.
431Rules of the Supreme Court˙Objection to certificate14.Any person affected by a certificate,
whether upon a first inquiry or afurther inquiry,
may traverse the same, or object thereto, within 2 monthsafter
the filing of the certificate, or within such further period as may
beallowed by the Court or a Judge.˙Mode of making objection15.(1)A person
desiring to traverse or object to a certificate must file intheregistrywithintheprescribedtimeanoticespecifyingwhethertheperson denies any, and, if so, which,
of the findings of fact set forth in thecertificate, or
whether the person objects to the certificate on some otherground;andmustonthesamedayserveacopythereofontheAttorney-General.(2)Thenoticemustgiveanaddressforservice,asinthecaseofanappearance to a
writ of summons.˙Proceedings on traverse16.If the notice denies any of the facts
found by the certificate, the likeproceedings shall
be had and taken, and within the same times, as if thecertificatewereastatementofclaiminanaction,andtheobjectorhadpleaded the notice as his or her defence, but
so that the burden of proof shalllie on the
objector.˙Setting aside certificate17.(1)If the objector
does not deny any of the findings of fact set forth inthe
certificate, the notice must specify the grounds of his or her
objection;and the objector must, within 30 days after
filing the objector’s notice, applyto the Court or a
Judge for an order setting aside the certificate.(2)Upon the hearing of the application
the Court or Judge may confirmthe certificate
with or without amendment, or may quash the certificate, andin
the latter case may direct the issue of a writ of further
inquiry.
432Rules of the Supreme Court˙Formal defects18.(1)A
writ of inquisition or certificate shall not be quashed or
avoidedbyreasonofanyomissionorinformalitywhichiscapableofbeingsupplied or
amended, and the Court or a Judge may make any amendment,or
direct any proceedings to be taken, which may be just.(2)The Court or a Judge may at any time
direct that the certificate shallstand good,
notwithstanding any defect specified in the direction, and
anysuch direction shall be forthwith endorsed on
the certificate by the properofficer, and
shall have effect as part of the certificate.˙Application of rules to other cases19.(1)Rules 1 to 18
may be applied, with the necessary variations, andso
far as it is not otherwise provided by law, to inquests of office
touchingany title or claim of the Crown to or in
respect of goods or chattels.(2)But
nothing in this rule shall invalidate any proceedings
conductedotherwise than in accordance with these rules
which would otherwise bevalid.˙Saving
of prerogative rights20.Nothing in this
order shall take away or prejudice any right, title, orprerogative of the Crown.†ORDER 84—COMMITTAL FOR CONTEMPT OFCOURT˙Contempt in the face of the Court1.(1)Whenapersonisallegedtobeguiltyofcontemptofcourt,committed in the
face of the Court, or in the hearing of the Court, the Courtmay,
by verbal order, direct the person to be arrested and brought
before itforthwith, or the presiding Judge may issue a
warrant under the Judge’shand for the arrest of the accused
person.
433Rules of the Supreme Court(2)When the accused person is brought
before the Court, the Court shallcause the accused
person to be informed orally of the nature of the contemptwith
which the accused person is charged, and shall require the
accusedperson to make his or her defence to the
charge, and shall after hearing theaccused person
proceed, either forthwith or after adjournment, to determinethe
matter of the charge, and shall make such order for the punishment
ordischarge of the accused person as may be
just.(3)The accused person shall be detained
in custody until the charge isdisposed of,
unless the Court allows the accused person to be discharged
onbail.˙In
other cases2.Incasesotherthanthoseinrule1mentioned,applicationforpunishment for contempt of court shall be
made by motion, upon notice tothe accused
person, for an order that the accused person be committed toprison for his or her contempt.˙Form of notice3.(1)The
notice of motion shall specify the nature of the contempt ofwhich
the accused person is alleged to be guilty.(2)It
shall be entitled in the cause or matter (if any) with reference
towhich the contempt is alleged to have been
committed, or, if it is not allegedto have been
committed with reference to any particular cause or matter,shallbeentitled‘TheQueenagainst’theaccusedperson,namingtheaccused person.˙Service4.The
notice of motion shall be served personally unless the Court
orJudge otherwise orders.˙Warrant5.(1)Whenanoticeofmotionforthecommittalofapersonforcontempt has been filed, if it is made to
appear to a Judge that the accused
434Rules of the Supreme Courtperson is likely to abscond or otherwise
withdraw himself or herself fromthe jurisdiction
of the Court, the Judge may by warrant under the Judge’shand
direct that the accused person shall be arrested and detained in
custodyuntil the accused person gives security in
such sum as the Judge may directto appear in
person and answer the charge and submit to the judgment ofthe
Court.(2)The warrant shall be directed to the
sheriff.(3)All police officers in the State shall
be required to aid and assist thesheriff in the
execution of the warrant and the sheriff or any such policeofficer may deliver the accused person to the
superintendent of any prisonandsuchsuperintendentshallreceivethesaidaccusedpersonandtheaccused person safely keep in the said
prison until such time as the Court orthe sheriff shall
direct.˙Interrogatories may be
administered6.(1)OnthehearingofthemotiontheCourtmayordertheaccusedperson to answer
on oath within 4 days interrogatories to be exhibited to theaccused person touching his or her
contempt.(2)The answer to the interrogatories
shall be made by affidavit.˙Adjournment7.Whentheaccusedpersonisorderedtoanswerinterrogatories,thehearing of the motion shall be adjourned for
a sufficient time to allow theanswer to be made
and filed.˙Punishment8.Upon
the hearing of the motion the Court may impose a fine
insteadof ordering the accused person to be
committed to prison, or may impose afine in addition
to ordering his or her committal; and, when it imposes afine,mayorderthattheaccusedpersonshallbeimprisoned,orfurtherimprisoned, until
the fine is paid, or instead of passing sentence, dischargetheoffenderonrecognisanceinaccordancewiththeprovisionsoftheCriminal Code, section
19(9).
435Rules of the Supreme Court˙Order of committal9.When
the accused person is ordered to be committed to prison, theorder
of committal shall specify the prison to which the accused person
is tobe committed.˙Discharge10.The
Court may order the discharge of a person committed to
prisonfor contempt notwithstanding that the time
for which the accused personwas ordered to be
committed has not expired.˙Costs11.The costs of an application for
committal shall be in the discretion ofthe Court,
whether an order for committal is made or not.†ORDER 85—APPEALS FROM LAND APPEALCOURT†2.
Appeals by way of special case˙Notice
of appeal9.When the Crown is a respondent to an
appeal from the Land AppealCourt, the notice
of appeal shall be served on the chief executive of thedepartment in which theLand Act
1962is administered.˙Evidence of notice to be transmitted10.(1)In the case of
appeals by way of special case, the appellant shallwith
the case transmit to the registrar of the Supreme Court an
affidavitstating that the notice of appeal, together
with the copy of the special case,has been duly
served on the other or respondent party.(2)The
registrar shall note upon the case, when received by the
registrar,
436Rules of the Supreme Courtthe
day when it was so received, and, if it was transmitted to the
registrar bypost, the day on which it purports to have
been posted.˙Setting down11.(1)The
appellant must, within 14 days after the case is received by
theregistrar, set the same down for
hearing.(2)If the appellant fails to do so, any
other party may set it down forhearing.˙General provisions12.Except as otherwise provided by this order,
the ordinary practice ofthe Court shall be followed in
proceedings relating to appeals under the Act.†3.
Proceedings in relation to arbitration˙Definition13.In
rules 14 to 18—“the Act”means theCommercial Arbitration Act 1990.˙Application14.(1)This rule and
rules 15 to 18 apply to—(a)arbitrationproceedingsinrespectofwhichtheCourthasjurisdiction under the Act; and(b)proceedings in the Court under the
Act.(2)Thefollowingrulesdonotapplytoproceedingsmentionedinsubrule (1)—(a)order 47, rule 32;(b)order 62, rule 9;(c)order 90, rule 10.
437Rules of the Supreme Court˙Jurisdiction15.ThejurisdictionandpowersoftheCourtundertheActmaybeexercised—(a)by a
Judge; and(b)except under sections 38 to 45 of the
Act, by a Master.˙Procedure16.(1)AnapplicationundertheActortheserulesistobemadebymotion.(2)An
application for leave under section 33 of the Act to enforce
anaward as a judgment or order of the Court
must—(a)be accompanied by evidence of—(i)the agreement to arbitrate and the
award; and(ii)the extent (if
any) to which the award has been compliedwith; and(b)statethenameandaddressofthepersonagainstwhomitissought to enforce the award.(3)Unless otherwise ordered—(a)an application for leave to enforce an
award need not be served onanyone;
and(b)the award may not be enforced for 14
days after service of theorder granting leave to enforce
it.˙Time17.(1)An
application—(a)for the leave of the Supreme Court
under section 38(4)(b) of theAct to appeal on
a question of law arising out of an award; or(b)under section 42(1) of the Act to set aside
an award;must be filed and served within 21 days after
the award is made.(2)An application under section 39(1) of
the Act to determine a question
438Rules of the Supreme Courtoflawmustbefiledandservedwithin21daysafterthegivingoftheconsent mentioned in that
section.˙Offers to settle18.The
provisions of order 26 apply to an arbitration as if a reference
toa Court included a reference to an arbitrator
or an umpire.†ORDER 86—JURISDICTION OF THE
MASTERS˙Jurisdiction1.A
Master may exercise the jurisdiction of the Court—(a)whichbyvirtueofanystatute,practice,customortheserulesmay
be exercised by a Judge sitting in chambers except in
respectof the following proceedings and matters,
that is to say—(i)mattersrelatingtocriminalproceedings(otherthanapplications for
orders to review under theJustices Act 1886,section 209) or to the liberty of the
subject; and proceedingson the Crown side of the Court (other
than applications forordersnisiforcertiorariprohibition,mandamusorquowarranto);(ii)subjecttosubparagraph(v),applicationsforinjunctions,other than
injunctions so far (and so far only) as the sameare
ancillary to equitable execution or charging orders; andcontested applications for the appointment
of receivers or fordissolution of an injunction made by the
Court;(iii)applications for
the review of taxation of costs;(iv)applications under order 18A, order 64,
rules 1A to 1BB,order90,rule9andorder98orundertheLimitation ofActions Act
1974, section 31;(v)contestedapplicationsfortheguardianshiporcustodyofinfants.However, nothing
in this paragraph shall prevent a
439Rules of the Supreme CourtMasterfromentertainingapplicationsorfrommakingordersforinterimcustodyoraccess,eitherundertheChildren’sServicesAct1965orundertheinherentjurisdictionoftheCourtorfrommakingordersforthosepurposes which
include relief by way of injunction;(vi)applicationsinmatterspendingintheHighCourtofAustralia;(viii)proceedingsinanyaction,cause,ormatterinrespectofwhich a Judge shall order that this rule
shall not apply, solong as such order shall be in force.A
Judge may at anytime make and may rescind any such
order;(ix)proceedingsorclassesofproceedingswhichtheChiefJustice shall
from time to time order to be excepted;(x)the
hearing and determination of applications for provisionout
of estates of deceased persons under section 41 of theSuccession Act 1981, unless with
the consent of all parties;(xi)proceedings,ifcontested,undertheTrustsAct1973,orundertheSuccessionAct1981,butsubjecttosubparagraph (x);(xii)
proceedingsunderthePropertyLawAct1974(exceptuncontestedproceedingsundersections38and41andproceedings under sections 257(3) and (4)
and 258(3) and(4));(xiii)proceedings under theLand
Title Act 1994;(xiv)subject to paragraphs (g) and
(h), proceedings under or byvirtue of any
companies legislation as defined in rule 12;(xv)
proceedings, if contested, under theCommercial
ArbitrationAct 1990;(b)in respect of the approval of
compromises on behalf of personsunder
disability;(c)in respect of trial (except with a
jury) or proceedings where theonly matters in
question are—(i)the amount of damages and costs;
or
440Rules of the Supreme Court(ii)the value of
goods and costs, or the amount of damages, thevalue of goods
and costs;(d)inrespectoftrialofanissuepursuanttoadirectionunderorder 59, rule
8;(e)in respect of any direction by consent
for entry of judgment andany order by consent;(f)notwithstanding the provisions of
paragraph (a)(i), in respect ofpunishment for
contempt in the face of the Court or in the hearingoftheCourt,wheretheCourtisconstitutedbytheMasterconcerned and
punishment for breach of an undertaking given tothe
Court constituted by a Master and for failure to comply withan
order of the Court constituted by a Master;(g)in
respect of proceedings, if uncontested, under any companieslegislation, as defined in rule 12, for;
confirmation of reduction ofshare capital;
summoning of a meeting of creditors or memberstoconsideracompromiseorarrangement;appointmentofaliquidatororprovisionalliquidator;winding-upofacompany;extensionoftimewithinwhichtoregisteracharge;byaliquidator for the consent, approval,
or authority of the Court toexercise a power
or do an act in the winding-up; by a liquidatorfor his or her
release with or without dissolution of the company;(gg)
in respect of proceedings commenced on or after 1 July 1982
astowhichjurisdictionisconferreduponaMasterbytheCompanies (Queensland) Rules
1985;(h)inrespectoftheexamination(whetherornotinpublic)ofanofficer or former officer of a
company, but not so as to authorisethe making of an
order for repayment or restoration of money orproperty or for
payment of damages;(i)in respect of motions for probate and
for letters of administrationwhere an
applicant is out of the jurisdiction;(j)in
respect of a motion to make absolute in the first instance
anorder nisi for certiorari, to quash a
conviction, which he or shehas made on the
application of the Crown pursuant to this rule;(k)inrespectofsuchotherproceedingsandmattersastheChief
441Rules of the Supreme CourtJustice shall from time to time direct,
whether by deletion of anexception under paragraph (a) or
otherwise.˙Effect of decisions2.Subject to these rules every judgment order
or decision given or madeby a Master in the exercise of the
Master’s jurisdiction shall be as valid andbindingon,andbeenforceableinthesamemanneragainstallpartiesconcerned as a
judgment order or decision given or made by a Judge.˙References3.The
office of a Master shall be deemed to be Judge’s chambers for
thepurposes of any matter which is authorised by
or under these rules to bedealt with by a Master and in relation
to such matters references in theserules to a Judge
shall be deemed to be references to a Master.˙When
matters allotted to Masters may be brought before Judge4.No matter which is authorised by or
under this order to be dealt withby a Master shall
be brought before a Judge or the Court except—(a)on a
reference by or removal from the Master; or(b)on
an appeal under this order; or(c)at a
place other than Brisbane if no Master is sitting at that
place;or(d)by special leave
of the Court or a Judge.˙Master acting for
another Master5.On the application of any party to a
matter any Master may, and if thecircumstances
require it shall, hear and dispose of such matter on behalf
ofanyotherMasterbywhomtheapplicationwouldotherwisehavebeenheard.
442Rules of the Supreme Court˙Reference and removal6.(1)AMastermay,whethertheMastershallhaveentereduponthehearingthereofornot,refertoaJudgeinchambersanyapplicationormatter which the Master shall think proper
for the decision of a Judge andthe Judge may
either dispose of the matter or refer it back to the Masterwith
such directions as the Judge may think fit.(2)AJudgemay,beforetheconclusionofanyproceedingsbeforeaMaster on application by a party order
that such proceedings be removed asthe Judge shall
direct.(3)Uponthereferenceofanyproceedingsundersubrule(1)ortheremoval of any
proceedings under subrule (2), the Judge may(a)hear
and determine any matter in the proceedings in respect ofwhich matter the proceedings were before the
Master; or(b)determine any question arising in the
proceedings and remit theproceedingstotheMasterwithsuchdirectionsastheJudgethinks
fit.(4)Pending the final disposal of the
application or matter the Master mayupon referring
the same to a Judge in chambers make such interim order asthe
Master shall think just.˙Appeal to Court of
Appeal7.(1)AnappealshalllietotheCourtofAppealfromanydecision,judgment or order
made or given by a Master under rule 1(a)(x), (c) and (f)but
an appeal shall not lie to the Court of Appeal from any other
decisionjudgment or order made or given by a Master
except by leave of the Courtor a
Judge.(2)Order 70 with all necessary
adaptations shall apply to such an appealas if it were an
appeal from a Judge.˙Appeal to Judge in
chambers8.(1)Subject to rule
7, any person affected by any order or decision of aMaster may appeal therefrom, by notice in
writing, to a Judge in chambers.(2)Unless otherwise ordered by the Judge or the
Master the notice shall
443Rules of the Supreme Courtbe
served, and a copy filed, within 5 days after the decision
complained of,and there shall be at least 2 clear days
between service of the notice ofappeal and the
day of hearing.(3)The notice of appeal shall set forth
brief particulars of the decisioncomplained of,
shall give particulars of the grounds of such complaint, andshall
set out the order sought by the appellant.(4)The
appeal shall be by way of a hearing of the application de
novo.(4A)Further evidence
may be received, and the Judge may exercise theJudge’s own
discretion without regard to the manner in which the
discretionhas been exercised by the Master.(5)Except by leave of a Judge no appeal
shall lie from the decision of aJudge under this
rule.˙General powers9.AMastershall,forthepurposeofanyproceedingswithintheMaster’s jurisdiction, have full power
to issue advertisements, to summonpartiesandwitnesses,toadministeroaths,totakeaffidavits,toreceiveaffirmations,toexaminepartiesandwitnessesvivavoceandtoreceiveevidence upon
affidavit.˙Default in compliance10.Partiesandwitnessessosummonedshallbeboundtoattendinpursuance of any such summons, and shall be
liable to process of contemptinlikemanneraspartiesorwitnessesarenowliabletoincaseofdisobedience to any order of the Court, or in
case of default in attendance inpursuanceofanyorderoftheCourtorofanywritofsubpoenaadtestificandum,andallpersonsswearingorreaffirmingbeforeandsuchMaster shall for
any wilful and corrupt false swearing or affirming be liableto
the penalties of perjury.˙Distribution of
business11.The distribution of business between
the Masters shall, subject to thedirection of the
Chief Justice, be by direction of the senior Master.
444Rules of the Supreme Court12.In rule 1—“companies
legislation”means theCompanies Act
1961; the CompaniesRegulations;
theCompaniesRules1963; theSecurities Industry Act1975;theCompanyTake-oversAct1979;andanylegislation(includingrulesorregulations)enactedinconsequenceoftheAgreement referred to in theCompanies and Securities
(InterpretationandMiscellaneousProvisions)(ApplicationofLaws)Act1981,section 3.†ORDER 87—THE REGISTRY˙Great
seal of the Court1.The seal of the Supreme Court shall be
in the custody of the registraras the deputy of
the Chief Justice, and shall, when not in actual use, be
keptunder lock and key.˙Seal
in Central, Northern and Far Northern Court2.(1)The
seals of the Supreme Court to be used in the Central,
NorthernandFarNorthernCourtshallbeinthecustodyoftheregistrarsoftheCentral, Northern and Far Northern
Court, respectively, as deputies of theChief Justice,
and shall, when not in actual use, be kept under lock and
key.(2)All documents to which the seal of the
Supreme Court is affixed atthose places
shall also be impressed with an office seal bearing the
words‘SupremeCourt,Rockhampton’,or‘SupremeCourt,Townsville’or‘Supreme Court, Cairns’, as the case may
be.˙To what documents affixed3.The seal of the Supreme Court shall be
affixed to all commissionsissued by authority of the Court or a
Judge, whether under the authority ofany statute or of
these rules, to all exemplifications of proceedings in theCourt, to all grants of probate or
administration, whether by way of originalgrant or by
sealing a grant made elsewhere, to all certificates of
admission
445Rules of the Supreme Courtof
persons to practise as barristers, solicitors, or conveyancers of
the Court,to all writs of certiorari, mandamus,
prohibition, and habeas corpus, and toall documents
issued from the Court for use beyond the jurisdiction of theCourt, not being writs or other documents for
service on a party to a causeor matter, and to
such other documents as the Court or a Judge may in anycase
direct.˙Office seals4.The
registrar shall keep a seal (the“office
seal”) which shall bear thewords ‘Supreme
Court Office’, with the word ‘Brisbane’, ‘Rockhampton’,‘Townsville’ or ‘Cairns’, as the case may be,
which shall be affixed to allwrits,judgments,andorders,andtoallotherdocumentswhichareauthorised to be sealed, except as
provided in rule 3.˙Rules of court5.(1)Theregistrarshallcountersignallrulesofcourtmadeandpromulgated by the Judges, and shall
cause copies thereof, certified by theregistrar, to be
transmitted to the Department of Justice and to be publishedin
the Gazette.(2)Theregistrarshallkeeptheoriginalsofallsuchrules,andofallformer rules and orders heretofore made, in
safe custody, and shall keep anindex
thereof.˙Custody of papers6.(1)The
registrar shall have the custody of all the records of the
Court,and of all documents filed in the registry,
or ordered to be deposited thereinfor safe custody,
or to be impounded.(2)The registrar shall, a sufficient time
before the time appointed forholding any
sittings or circuit court, deliver to the associate of the
Judgewho is to preside at such sittings or circuit
court all documents necessaryfor use at the
hearing or trial of any cause or matter to be there heard ortried; and the associate shall return the
same to the registrar forthwith afterthe conclusion of
the sittings or circuit court.
446Rules of the Supreme Court˙General authority of registrar7.Theregistrarshallhavethegeneralsupervisionoftheofficersemployed in the
registry, and shall distribute their duties from time to
timein such manner as may be most expedient, but
so that when any officer isappointed to
discharge any special duty such duty shall be discharged bysuch
officer.˙Duty of officers of registry8.All acts and things which by these
rules are required to be performedand done in, or
with reference to, the registry shall be done by the
registraror officers employed in the registry, or with
reference to them, as the casemay be.˙Testing of writs etc.9.Everywritandcommissionshallbetestedanddatedinthesamemanner as
prescribed in the case of a writ of summons in an action,
and,unless otherwise provided by these rules,
shall be issued on a praecipe filedby the party
applying for the instrument.˙Sealing writs etc.10.(1)Any
person desiring to sue out any writ or commission authorisedby
law or by these rules, or by any other rules of court, may prepare
thesame in the prescribed form and present it
for issue to the registrar, and if itappears that the
writ is in proper form and that the person presenting it forissue
is entitled to sue out the same, the registrar or the registrar’s
clerk shallsign the writ and seal it with the office
seal, and such signature and sealshall have the
same effect as if it were sealed with the seal of the Court,
andthe writ shall thereupon be deemed to be
issued.(2)However, if any such writ or
commission shall appear to the registrarat Brisbane,
Rockhampton, Townsville or Cairns on its face to be an abuseoftheprocessoftheCourtorafrivolousorvexatiousproceedingtheregistrar shall seek the direction of a Judge
who may direct the registrar toissue the same or
to refuse to issue the same without the leave of a Judgefirst
had and obtained by the party seeking to issue the
same.
447Rules of the Supreme Court˙Power of clerks11.(1)Writsandcommissionsmaybesignedfortheregistrar,anddocuments may be received and filed, by any
clerk in the registry to whomsuch duties are
assigned.(2)Judgments which are not actually
settled by the registrar may in likemannerbesignedfortheregistrarbyanyclerktowhomthatdutyisassigned.˙Fees
to be prepaid12.No document in respect of which a fee
is payable shall be sealed orreceived or filed
until the fee has been paid.˙Office
copies13.(1)Any person
entitled to have a copy of any record of the Court orof
any document filed in the registry may apply to the registrar for
an officecopy thereof, and the registrar shall
thereupon cause a copy of such recordordocumenttobemadeandexamined,andshallcausethesametobemarked with the words ‘office copy’,
and sealed with the office seal.(2)All
copies of documents so marked and sealed with the office
sealshall be presumed to be office copies duly
issued from the registry, andshallbedeemedtobecertifiedcopieswithinthemeaningofanylawrelating to the
admission in evidence of certified copies.(3)Office copies shall be ready to be delivered
within 48 hours after theyare bespoken.˙Date
upon document filed14.Upon every document which is filed in
the registry the date of filingit shall be
noted.˙Indexes to files to be kept15.(1)Properindexesorcalendarstothefilesorbundlesofalldocuments (including judgments and
orders) filed in the registry shall bekept so that they
may be conveniently referred to when required.
448Rules of the Supreme Court(2)The indexes or calendars and documents
shall, at all times duringoffice hours, be accessible to the
public on payment of the prescribed fee.˙Register of documents filed and proceedings
taken16.(1)In the registry
a record of all documents filed and all proceedingstaken
in every cause or matter shall be kept, showing the dates of filing
thedocuments and taking the proceedings, so that
all the proceedings in thecause or matter are shown consecutively
and in chronological order.(2)The record
shall, at all times during office hours, be accessible to
thepublic on payment of the prescribed
fee.˙Reference on judgment etc. to
record17.Every judgment, order, certificate,
petition, affidavit, or documentmade, presented,
or used in any cause or matter, shall be distinguished byhaving plainly written or stamped on the
first page thereof the year, and thenumber by which
the cause or matter is distinguished in the books kept atthe
registry.˙Searches18.Theregistrarshall,onarequestinwritinggivingsufficientparticulars, and
on payment of the prescribed fee, cause a search to be madeintheregistersorindexesundertheregistrar’scustody,andissueacertificate of the result of the
search.˙Certificate of proceedings in cause or
matter19.The registrar shall, at the request of
any person, whether a party ornot to the cause
or matter, and on payment of the prescribed fee, give acertificate specifying therein the dates and
general description of the severalproceedings which
have been taken in any cause or matter.˙Certificates to be filed20.All
certificates of the registrar made in pursuance of a judgment
ororder shall be filed in the
registry.
449Rules of the Supreme Court˙Restrictions on removal of documents
from registry21.(1)No record of the
Court or other document shall be taken out of theregistry without the order of the Court or a
Judge, and no subpoena for theproduction of any
such document shall be issued.(2)However, if a court order in a proceeding is
the subject of an appealto another court (the“other court”), the registrar
may, without an order ofthe court or a judge, give or lend the
court records and other documents forthe proceeding to
the registrar (however called) of the other court.˙Fees of officer required to attend away
from court building22.Any officer, not being the associate
of the Judge presiding at theCourt, who is
required to attend with any record or document at any courtor
place out of the Supreme Court building shall be entitled to
require thatthe solicitor or party desiring his or her
attendance shall deposit with theofficer a
sufficient sum of money to answer his or her just fees,
charges,and expenses in respect of such attendance,
and shall undertake to pay anyjust fees,
charges, and expenses which may not be fully answered by
suchdeposit.˙Deeds
ordered to be deposited to be left in registry23.Whenanydeedsorotherdocumentsareorderedtobeleftordeposited, whether for safe custody or for
the purpose of any inquiry inchambers or
otherwise, the same shall be left or deposited in the
registry,and shall be subject to such directions as
may be given by the Court or aJudge as to the
production thereof.˙Delivery of impounded documents24.(1)Impounded
documents, while in the custody of the Court, shallnot
be parted with, and shall not be inspected, except on an order made
bythe Court or a Judge.(2)Such
documents shall not be delivered out of the custody of the
Courtexcept upon an order made on motion in open
court.(3)However, impounded documents in the
custody of the Court shall,upontherequestinwritingofaCrownLawOfficerrepresentingthe
450Rules of the Supreme CourtCrown, or, in the case of documents directed
to be impounded under thelaws relating to stamps, upon the
request in writing of the Commissioners,be given into the
custody of such law officer or Commissioners.˙Scandalous matter25.The
Court or a Judge may order that any affidavit or other
documentfiled in the registry which contains
scandalous matter shall be taken off thefile, and may
order that the costs of the application be paid by the party
bywhom the same was filed or by the party’s
solicitor.˙Attendance of registrar in court26.The registrar or the registrar’s
deputy shall if required by the Court ora Judge attend
the sittings of the Court of Appeal, and also every Judgesitting in court, except when sitting for the
trial of causes, or in the criminaljurisdiction of
the Court.˙Directions to registrar28.Any party may apply to the Court or a
Judge ex parte in a summaryway for a
direction to the registrar to do any act which the party
applyingrequires the registrar to do, and which the
registrar refuses to do.†Admiralty
actions˙Minute book29.There shall be kept in the registry a
separate book (the“admiraltyminute
book”) in which the registrar shall enter in
order of date, under thehead of each admiralty action, and on a
page numbered with the number ofthe action, a
record of the commencement of the action, of all appearancesentered, all documents issued or filed, all
acts done, and all judgments andorders made in
the action, whether made by the Court or a Judge or byconsent of the parties.
451Rules of the Supreme Court˙Inspection of minute and caveat
books31.Any solicitor may, free of charge,
inspect the admiralty minute bookand admiralty
caveat book.˙Inspection of records32.The parties to an admiralty action
may, while the action is pending,and for 1 year
after its termination, inspect, free of charge, all the records
inthe action.˙By
whom to be made33.Except as provided by rules 31 and 32,
no person shall be entitled toinspect the
records in a pending admiralty action without the permission
ofthe registrar.˙After
action terminated34.Inanadmiraltyactionwhichisterminatedanypersonmay,onpayment of the prescribed fee, inspect
the records in the action.†ORDER
87A—FILING˙Filing1.(1)A
document may be lodged for filing by—(a)delivering it to the registry personally;
or(b)sending it to the registry, by
pre-paid post, in an envelope markedwith a note that
it contains court documents.(2)If a
document is lodged for filing in contravention of these rules,
theregistrar may refuse to accept the document
for filing.(3)A document lodged for filing under
these rules is not taken to be fileduntil it is
stamped as filed.
452Rules of the Supreme Court˙Filing by post2.(1)This
rule applies if a document is lodged for filing by post.(2)Thedocumentmustbeaccompaniedbythenumberofcopiesrequired by these
rules and a stamped envelope addressed to the filing partyor
the filing party’s solicitor.(3)Theregistrarmustreturntothefilingpartyorsolicitorintheenvelope—(a)anycopiesofthedocumentthat,undertheserules,havebeenlodged with the
document and endorsed or sealed by the registrar;or(b)if the document
is not accepted for filing—the document.(4)If,
on filing the document, a hearing is required before a
chamberjudge or registrar, the registrar must not
fix a return day earlier than 14 daysafter the filing
day.(5)If the document contains an affidavit
about a debt—(a)it must be attested on the day it is
posted; and(b)it may be relied on, for these rules,
until the end of 5 days afterthe day it is
attested.˙Risk3.A
document lodged for filing by post is at the risk of the filing
party.˙Postal dealing fee4.(1)A
party must pay the prescribed fee (the“postal dealing
fee”) forlodging a
document for filing by post.(2)Thepostaldealingfeeisinadditiontoanyotherfeepayableforlodging the document and is not refundable if
the document is not acceptedfor
filing.
453Rules of the Supreme Court†ORDER 88—DRAWING UP JUDGMENTS
ANDORDERS˙By
whom judgments and orders to be drawn up1.Judgments and orders, whether given or made
in court or chambers,or by default, shall be drawn up by the
registrar or under the registrar’sdirection, unless
otherwise directed by the Court or a Judge.˙Entry
not required2.It shall not be necessary to enter any
judgment or order, whether givenor made before or
after the coming into operation of these rules, except asprovided by order 44 and this order.˙Documents to be filed before judgment
or order signed3.No judgment or order founded, in whole
or part, on a petition, or onaffidavits,
written admissions, or other written documents, shall be
signeduntil such petition, admissions, affidavits,
or other documents, have beenfiled in the
registry.˙Documents to be left with registrar on
bespeaking judgment or order4.At
the time of bespeaking a judgment or order, the party
bespeakingthe same shall leave with the registrar his
or her counsel’s brief (if any) andsuch other
documents as may be required by the registrar for the purpose
ofenabling him or her to draw up the
same.˙Registrar may require party to submit
draft5.The registrar may require the party
bespeaking a judgment or order toprepareadraftofthesameandleavethesameintheregistryfortheregistrar’s use and assistance, and may
accept the draft so prepared and leftas the
registrar’s own draft of the judgment or order, which such
alterations(if any) as the registrar may think
fit.
454Rules of the Supreme Court˙Time for bespeaking judgment or
order6.Everyjudgmentorordershallbebespoken,andtherequisitedocumentsmentionedinrule5butoneshallbeleftwiththeregistrar,within 7 days
after the judgment or order is finally given or made by theCourt
or Judge.˙Where judgment or order not
bespoken7.If any judgment or order is not
bespoken, and the requisite documentsarenotleftwiththeregistrarwithinthetimeprescribedbyrule6,theregistrar may decline to draw up the
judgment or order without the directionof the Court or a
Judge.˙Appointment for settling judgment or
order8.At the time of delivering out the
draft of a judgment or order which, inthe opinion of
the registrar, ought to be settled in the presence of the
parties,the registrar shall deliver out to the party
on whose application the draft hasbeen prepared an
appointment in writing of a time for settling the same.˙Notice of appointment to be served on
opposite party9.Anoticeoftheappointmentshallbeservedontheoppositeparty1
clear day at least before the time thereby appointed for settling
the draft,and the party serving the notice and the
party so served shall attend theappointment, and
produce to the registrar counsel’s briefs (if any) and suchother
documents as may be necessary to enable the registrar to settle
thedraft.˙Service of notice of appointment10.Service of the notice of appointment
shall be effected by leaving it atthe place for
service of the party to be served, or by transmitting it by
postto such party at such place for
service.
455Rules of the Supreme Court˙Proof of service11.At
the time appointed for settling the draft the registrar shall
satisfyhimself or herself in such manner as the
registrar may think fit that serviceof the notice of
appointment has been duly effected, and for that purposemay
require evidence on oath.˙Appointment for
passing judgment or order12.When the draft
has been settled by the registrar, the registrar shallname
a time in the presence of the several parties, or else deliver out
anappointment in writing of a time for passing
the judgment or order; and inthe latter case
notice of the appointment shall be served by the party towhom
the appointment is delivered on the opposite party, and the
serviceshall be proved, in the manner prescribed by
rules 10 and 11 with referenceto an appointment
to settle the draft of a judgment or order.˙Default in attending appointment with
documents13.(1)If any party
fails to attend the registrar’s appointment for settlingthe
draft of a judgment or order, or for passing a judgment or order,
or failstoproducehisorhercounsel’sbriefsandsuchotherdocumentsastheregistrar may require to enable the
registrar to settle such draft, or to passsuch judgment or
order, the registrar may proceed to settle the draft, or topass
the judgment or order, in his or her absence, and the registrar
shall beat liberty to dispense with the production of
counsel’s briefs, and to actupon such
evidence as the registrar may think fit of the actual appearance
bycounselofthepartyfailingtoattend,orwiththeproductionofsuchdocumentsorpapersasaforesaid,ormayrequirethemattertobementioned to the Court or Judge.(2)When such matter has been so mentioned
as required by the registrarthe Court or
Judge may direct such party or the solicitor for the party
sofailing to attend before the registrar or to
produce such documents or papersasaforesaid(unlessasatisfactoryexplanationofsuchfailurebeforthcoming) to pay all or any part of
the costs of drawing up and enteringthe judgment or
order as the Court or Judge shall think fit.
456Rules of the Supreme Court˙Adjournment of appointments14.The registrar may adjourn any
appointment for settling the draft of ajudgment or
order, or for passing a judgment or order, to such time as
theregistrar may think fit, and the parties who
attended the appointment shallbe bound to
attend such adjournment without further notice.˙Settling and passing judgment or order
without any appointment15.(1)Notwithstanding
rules 1 to 14, the registrar may, in any case inwhichtheregistrarmaythinkitexpedientsotodo,settleandpassanyjudgment or order, without making any
appointment for either purpose andwithout notice to
any party.(2)A judgment or order when settled and
passed shall be engrossed bythe party having
the carriage of the judgment or order.(3)A
judgment or order shall be marked to show by whom it was
made.˙Judgments and orders to be drawn up
within 14 days15A.(1)Everyjudgmentorordershallunlessotherwiseorderedbedrawnupandenteredwithin14daysfromthedatethereof,andifanyjudgment or order shall not have been drawn
up and entered within the timeaforesaid the
registrar responsible for the drawing up of such order mayreport to the Judge in writing as to the
reason why the provisions of thisrule have not
been complied with and whether in the registrar’s opinion
anyand which of the parties or their solicitors
are responsible for the delay, andthereupon the
Judge may direct such parties or solicitors to attend before
theJudge and may unless a satisfactory
explanation be forthcoming make suchorder for the
payment of all or any part of the costs of drawing up andentering the judgment or order as the Judge
shall think fit.(2)The Judge may also direct that as
against any party responsible forsuch delay the
time for appealing from such judgment or order shall run asfrom
the date when the same ought to have been drawn up and entered
inaccordance with this rule.
457Rules of the Supreme Court˙Judgments and orders to be
filed—duplicates16.(1)Every judgment
and order shall be filed in the registry.(1A)An
entry of the filing shall be made in special books to be kept
forthat purpose.(1B)Alljudgmentsandordersgivenandmadeinanyyearshallbenumbered consecutively in the order in
which they are filed.(1C)Everyjudgmentandordersofiledshallbedeemedtobedulyentered, and the
date of such filing shall be deemed the date of entry.(1D)Orderswhicharenotrequiredtobeformallydrawnupbeforebeing acted upon
need not be entered, unless it becomes necessary to servethe
order for any purpose.(2)A certified
duplicate of every judgment or order shall, 1 clear dayafter
the same has been filed, or in urgent cases sooner if so directed
by theregistrar, be supplied by the registrar
without fee to the party having thecarriage of the
judgment or order; and whenever any rule or order or thepractice of the Court requires the production
or service of a judgment ororder, it shall
be sufficient to produce or serve the duplicate.(3)Inthecaseofprintedordersaprintedcopyshallbemarkedasaduplicate and duly examined before
sealing the same.(3A)In the case of
written orders the duplicate shall be written withoutabbreviations, and carefully examined, and
the examination thereof certifiedin such manner as
the registrar may direct; and no duplicate shall be sealedunless such examination has been so
certified.(3B)Every duplicate
shall be sealed before being issued, and there shallbe
noted thereon the number of the judgment or order, the date of
entry, andthe amount of the fee paid on the original
judgment or order.(4)A further duplicate may at any time,
with the sanction of the registrarandonpaymentoftheprescribedfee,beissuedonproductionoftheduplicate first issued, or on the
registrar being satisfied of the loss of thatduplicate, and
that the person applying is properly entitled to it.(5)A judgment or order shall not be
amended except upon production ofthe duplicate or
duplicates, or the duplicate last issued, as the case may
be,which shall, after the original order has
been amended, be also amended in
458Rules of the Supreme Courtaccordancetherewith,underthedirectionoftheregistrar,andtheamendment in the duplicate shall be
sealed under the like direction.˙Certificate for special allowance17.The registrar shall if requested to do
so by any party at the time ofany attendance
before the registrar for the purpose of settling the draft of
ajudgmentororder,orofpassingajudgmentororder,certify,fortheinformationofthetaxingofficer,whetherintheregistrar’sopinionanyspecial allowance ought to be made on
taxation of costs in respect of suchattendance, or in
respect of the preparation of the draft by any party whomtheregistrarhasrequestedtopreparethesame,onthegroundthatthejudgment or order is of a special
nature or of unusual length or difficulty.˙Orders
for payment into or out of court18.Orders for the payment or transfer of money
or securities into courtor out of court shall be drawn up in
conformity with the regulations madebytheGovernorinCouncilundertheprovisionsoftheSupremeCourtFunds
Act 1895.†ORDER 89—THE
SHERIFF AND OTHER OFFICERSCHARGED WITH SERVICE AND EXECUTION
OFPROCESS˙Process to be returned1.Thesheriff,andeveryotherofficerchargedwiththeexecutionofprocess, shall return the process into court
if required by the party by whomit is sued
out.˙Mode of making returns2.The return shall be made by filing the
original process in the registry,with a
certificate endorsed thereon or annexed thereto, and signed by
the
459Rules of the Supreme Courtsheriff or the sheriff’s deputy, or such
other officer as aforesaid, and settingforth what has
been done under the process.˙Return
of non est inventus3.When a writ of summons or other
process is delivered to the sheriff orother officer
specially appointed in that behalf for service upon any
person,and the sheriff or officer is unable to find
the person to be served, the sherifforofficershall,ifsorequiredbythepartybywhomtheprocesswasdelivered to the party, return the process
into court in the same manner as inthecaseofprocessofexecution,withacertificatesettingforthsuchinability.˙Attendance of sheriff in court4.The sheriff or the sheriff’s deputy
shall if required by the Court or aJudge attend the
sittings of the Court of Appeal, and all sittings of the
Courtin its criminal jurisdiction, and all
sittings of the Court for the trial of causes,and shall also
attend any Judge of the Court when sitting in court on anyoccasion when the sheriff or officer is
required by the Judge to do so.˙Process in admiralty actions to be executed
by marshal5.The marshal shall execute, personally
or by the marshal’s officers, allinstruments
issued from the Court which are addressed to the marshal,
andshall make returns thereof in the same manner
as the sheriff.˙Or the marshal’s officers6.Whenever,byreasonofdistanceoranyothersufficientcause,themarshal cannot conveniently execute any
instrument in person, the marshalshall employ some
fit person as his or her officer to execute the same.˙To be left with marshal with written
instructions7.Every instrument to be served or
executed by the marshal shall be leftwith the marshal
by the party at whose instance it is issued, with writteninstructions for the service or execution
thereof.
460Rules of the Supreme Court˙Verification of service or
execution8.(1)The service or
execution of any instrument by the marshal shall besufficiently proved by the marshal’s return,
which shall state by whom thewarrant has been
served or executed, and the date and mode of service orexecution, and shall be signed by the
marshal.(2)When any instrument issued in an
admiralty action is served by anyother person, the
service shall be proved by affidavit.†ORDER 90—TIME˙Exclusion of Sundays and court
holidays1.When any limited time less than 6 days
from or after any date or eventisappointedorallowedfordoinganyactionortakinganyproceedingSaturdays,Sundaysandcourtholidaysshallnotbereckonedinthecomputation of such limited
time.˙Time expiring on close day2.When the time for doing any act or
taking any proceeding expires on aSaturday,Sundayorcourtholiday,andbyreasonthereofsuchactorproceeding cannot
be done or taken on that day, such act or proceedingshall, so far as regards the time of doing or
taking the same, be held to beduly done or
taken if done or taken on the next day which is not a
Saturday,Sunday or court holiday.˙No
delivery of pleadings in vacation3.Pleadings shall not be delivered or amended
in vacation except withthe leave of the Court or a Judge or
with the consent of all the parties to theaction.
461Rules of the Supreme Court˙Vacation not to be reckoned in time for
delivery etc. of pleadings4.The time of the
vacations shall not be reckoned in the computation ofthetimesappointedorallowedbytheserulesforfiling,amending,ordelivering any pleading, unless so
directed by the Court or a Judge or unlessthe parties have
so agreed in writing.˙Time for giving
security for costs, when not to be reckoned5.The
day on which an order for security for costs is served, and
thetime thenceforward until and including the
day on which such security isgiven, shall not
be reckoned in the computation of the time allowed forpleading, answering interrogatories, or
taking any other proceeding in thecause.˙Power of Court or Judge to enlarge or
abridge time6.The Court or a Judge may enlarge or
abridge the time for doing anyact or taking any
proceeding allowed or limited by these rules, or allowed orlimited for the like purpose by any order of
the Court or a Judge, whetherso allowed by way
of enlargement or otherwise, upon such terms (if any)as
the justice of the case may require; and any such enlargement may
beordered although the application for the same
is not made until after theexpiration of the
time originally allowed or limited.˙Appointment of early day for trial in
admiralty actions7.In admiralty actions either party may,
at any stage of the proceedings,apply to the
Court or a Judge for an order that the trial shall take place on
anearly day to be appointed by the Court or
Judge; and on such application theCourt or Judge
may appoint that the trial shall take place on any day orwithinanytimewhichtheCourtorJudgemaythinkfit;andforsuchpurpose may dispense with giving notice of
trial, or may abridge the time ortimes appointed
by these rules for giving notice of trial or for the delivery
ofpleadings, or for doing any other act or
taking any other proceeding in theaction, upon such
terms (if any) as may be just.
462Rules of the Supreme Court˙Time of day for service8.(1)Service of
pleadings, notices, summonses, orders, rules, and otherproceedings, shall be effected before 4
p.m.(2)Service effected after 4 p.m. on any
day shall, for the purpose ofcomputing any
period of time subsequent to such service, be deemed tohave
been effected on the following day.˙Notice
after delay of 1 year9.(1)When no
proceeding has been taken in a cause for 1 whole yearfrom
the time when the last proceeding was taken, any party who desires
toproceed shall, before taking any step in the
cause, give a month’s notice toevery other party
of his or her intention to proceed.(2)When
3 years have elapsed from the time when the last proceedingwas
taken, no fresh proceeding shall be taken without the order of the
Courtor a Judge, which may be made either ex parte
or upon notice.(3)A summons on which no order has been
made shall not be deemed aproceedingwithinthisrule;butnoticeoftrial,althoughavoidedbynon-entry or countermanded, shall be deemed
such a proceeding.˙Time for application to set aside
award10.An application to set aside an award
may be made at any time notlater than the
fourth day of the sittings of the Court of Appeal held next
aftersuch award has been made and published to the
parties.˙Duration of caveat in admiralty
actions11.In admiralty actions a caveat, whether
against the issue of a warrant,the release of
property, or the payment of money out of court, shall notremain in force for more than 6 months from
the date thereof.˙Time for service in admiralty
actions12.In admiralty actions every instrument
requiring to be served shall beserved within 12
months from the date on which it bears date; otherwise theservice shall be of no effect.
463Rules of the Supreme Court†ORDER 91—COSTS†1.
Costs in general˙Costs to be in the discretion of the
Court1.(1)Subject to the
provisions of theJudicature Act 1876and these
rules,thecostsofandincidenttoallproceedingsintheCourt,includingtheadministration of estates and trusts,
shall be in the discretion of the Court orJudge.(2)However,nothinghereincontainedshalldepriveanexecutor,administrator,
trustee, or mortgagee who has not unreasonably instituted orcarriedonorresistedanyproceedingsofanyrighttocostsoutofaparticular estate
or fund to which he or she would be entitled according tothe
rules heretofore acted upon in courts of equity.(3)In addition, subject to rule 2, when
any cause, matter, or issue is triedwith a jury, the
costs shall follow the event, unless the Judge by whom suchcause, matter, or issue is tried, or the
Court, shall for good cause otherwiseorder.˙Limitation of costs2.(1)Iftheplaintiffinanactiontorecoveradebtordamagescommenced in the
Supreme Court recovers £10 ($20) or more but less thanthesumof£50($100),andtheactionwasonethatmighthavebeenbroughtinaMagistratesCourt,theplaintiffshallnotbeentitledtoanygreater costs
than the plaintiff would have recovered if the action had
beenbrought in such Magistrates Court unless the
Court or Judge so orders.(2)If the plaintiff
in an action to recover debt or damages commenced inthe
Supreme Court recovers less than £10 ($20), the plaintiff shall not
beentitled to any costs, unless the Court or
Judge so orders.(3)Subject to subrules (1) and (2), where
the plaintiff in an action torecoveradebtordamagesbroughtintheSupremeCourtrecoversanamount which the plaintiff could have
sued for and recovered by action in aDistrict Court
and the action was one which otherwise might have beenbrought in a District Court, the Court or a
Judge may when awarding costs
464Rules of the Supreme Courtorder
in its, his or her discretion that the plaintiff shall not be
entitled to anygreater costs than the plaintiff would have
recovered if the action had beenbrought in such
District Court.˙Costs of issues to follow event3.(1)Whenseveralissues,whetheroffactorlaw,areraiseduponaclaim or counterclaim, the costs of the
several issues respectively, both inlaw and fact,
shall, unless otherwise ordered, follow the event.(2)A judgment or order giving a party
costs except so far as they havebeen occasioned
or incurred by or relate to some particular issue or part ofthe
proceedings shall be construed as excepting only the amount by
whichthe costs have been increased by such issue
or proceedings.(3)The Court or Judge, when the whole
costs of a cause or of any issueor proceeding are
not intended to be given to a party, may, when practicable,direct taxation of the whole costs and award
such proportion thereof as theCourt or Judge
may think fit.˙Costs of cause removed from inferior
court4.If a cause is removed from an inferior
court which had jurisdiction inthe cause, the
costs in the Court below shall be costs in the cause.˙Costs of solicitor guardian ad
litem5.Whenasolicitoractsastheguardianadlitemofaninfant,orisappointed to be guardianad
litemof a mentally ill person, in any cause
ormatter, the Court or a Judge may direct that
the costs to be incurred in theperformance of
the duties of such office shall be borne and paid either bythe
parties, or some one or more of the parties, to the cause or matter
or outof any fund in court in which the infant or
mentally ill person is interested,and may give
directions for the repayment or allowance of such costs as
thejustice and circumstances of the case may
require.˙Costs out of estate6.Thecostsoccasionedbyanunsuccessfulclaimorunsuccessful
465Rules of the Supreme Courtresistance to any claim to any property shall
not be paid out of the estateunless the Court
or a Judge so orders.˙Costs as regards
particular shares7.The costs of inquiries to ascertain
the person entitled to any legacy,money, or share,
or otherwise incurred in relation thereto, shall be paid outofsuchlegacy,money,orshare,unlesstheCourtoraJudgeotherwiseorders.˙Distribution not to be delayed by
difficulties as to some shares8.When
some of the persons entitled to a distributive share of a fund
areascertained,anddifficultyordelayhasoccurredorislikelytooccurinascertaining the persons entitled to the
other shares, the Court or a Judgemayorderorallowimmediatepaymentoftheirsharestothepersonsascertainedwithoutreservinganypartofthosesharestoanswerthesubsequent costs of ascertaining the persons
entitled to the other shares; andinanysuchcasesuchordersmaybemadefortheascertainmentandpayment of the costs incurred down to and
including such payment as theCourt or Judge
may think just.˙Costs of excessive claims in admiralty
action9.In an admiralty action a party
claiming an excessive amount, either byway of claim or
of set-off or counterclaim, may be ordered to pay all costsand
damages occasioned by the excess.˙Tender
improperly rejected in admiralty action10.Inanadmiraltyaction,ifatenderisrejected,butisafterwardsaccepted, or is
held by the Court to be sufficient, the party rejecting thetender shall, unless the Court otherwise
orders, pay all the costs incurredafter the tender
is made.˙Set-off of damages and of costs in same
cause or matter11.When in any cause or matter any sum of
money is ordered to be paid
466Rules of the Supreme Courtby
one party to another, whether for debt, damages, or costs, and in
thesame cause or matter the party to whom such
sum is to be paid is orderedto pay any sum,
whether for debt, damages, or costs, to the party by whomthe
firstmentioned sum is to be paid, 1 of such sums shall be set off
againstthe other without any order for that purpose,
and the balance (if any) shallbe payable by the
party by whom the larger sum is ordered to be paid, andto
the other party.˙Set-off in different causes or
matters12.Money recovered by 1 party against
another party in any cause ormattershallnotbeset-offagainstmoneyrecoveredbythelatterpartyagainst the
former in another cause or matter, except subject to the liens
oftheir respective solicitors upon the sum so
recovered, but may be set-offsubject to such
liens.˙Costs of incidental applications13.Unless the Court or a Judge otherwise
orders, the costs of a motionor application in
a cause shall be deemed to be part of the costs of the causeof
the party in whose favour the motion or application is determined,
unlessthe motion or application is unopposed, in
which case the costs of bothparties shall be
deemed to be part of their costs of the cause, unless theCourt
or a Judge otherwise orders.˙Costs
of motion not disposed of14.When a motion or
application or other proceeding is ordered to standover
to the trial, and no order is made at the trial as to the costs of
suchmotion, application, or proceeding, the costs
of both parties of such motion,application, or
proceeding shall be deemed to be part of their costs of thecause.˙Costs
reserved15.When the costs of any motion or
application or other proceeding in acauseormatterarereservedbytheCourtorJudge,nocostsofsuch
467Rules of the Supreme Courtmotion, application, or proceeding shall be
allowed to either party withoutthe order of the
Court or Judge.˙Costs when further proceedings become
unnecessary16.When for any reason the further
prosecution of any cause or matterbecomes
unnecessary except for the purpose of determining by whom
thecosts of the cause or matter should be paid,
any party may apply to theCourt or a Judge to determine such
question, and thereupon the Court orJudge may make
such order as may be just.˙Costs of
unnecessarily expensive proceedings17.Whenapartytakesproceedingsofanunnecessarilyexpensivecharacter, the Court may order the costs
incurred by such proceedings, sofar as they are
in excess of the costs which would have been incurred byproceedings of a less expensive character, to
be borne and paid by the partyby whom the
proceedings are taken, although the party is otherwise
entitledto the costs of the cause or matter.†3. Scale of costs˙Costs
in general29.The fees payable to solicitors in
respect of business transacted bythem in the
Court, or the offices thereof, shall be as prescribed by this
order,and save as hereinafter provided, no other
fees shall be charged, either asbetween party and
party, or as between solicitor and client, in respect ofsuch
business as aforesaid.˙Costs to be in
general allowed on schedule 230.Incausesandmatterscommencedaftertheserulescomeintooperation,
solicitors shall be entitled to charge, and shall be allowed the
feesset forth in schedule 2, in all causes and
matters, and no higher fees shall beallowed in any
case, except as by this order otherwise provided.
468Rules of the Supreme Court˙Costs in small admiralty cases31.(1)When the sum in
dispute in an admiralty action does not exceed£50 ($100), or
the value of the res does not exceed £100 ($200),1/2only
ofthe ordinary costs on the scale shall be
allowed.(2)Whencostsareawardedtoaplaintiff,theexpression“sumindispute”means the sum
recovered by the plaintiff in addition to the sum (ifany)
counterclaimed from the plaintiff by the defendant; and, when costs
areawarded to a defendant, it means the sum
claimed from the plaintiff, inaddition to the
sum (if any) recovered by the defendant.˙Half-costs in admiralty action32.The Judge may, in any admiralty
action, order that half-costs onlyshall be
allowed.˙Costs as between solicitor and
client35.(1)The Court or a
Judge may, in any case in which costs are orderedto be
paid to any party out of an estate or fund, direct that the costs
shall beallowed and taxed as between solicitor and
client, and the costs shall beallowed and taxed
accordingly.(2)In the absence of any such direction,
costs so ordered to be paid shallbe taxed as
between party and party.†4. Taxation of
costs˙Trustee’s costs36.An
executor, administrator, or trustee, shall not be allowed in his
orher accounts any sum paid by the executor,
administrator or trustee to his orher solicitor for
costs unless and until the same have been duly taxed asbetween solicitor and client, or unless the
registrar is satisfied that the sameor some part
thereof ought to be allowed without formal taxation.
469Rules of the Supreme Court˙Receiver’s costs37.The
costs of a receiver appointed in any cause or matter may be
taxedby the taxing officer on the application of
the receiver, or of any party tosuch cause or
matter.˙Costs on an award38.Costs may be taxed on an award,
notwithstanding that the time forsetting aside the
award has not elapsed.˙Reference to
taxing officer39.(1)Everyreferenceforthetaxationofcostsshallbemadetothetaxing officer, who shall appoint a
time for taxation on the application of theparty claiming
the taxation.(2)No warrant to tax or other warrant
shall be necessary.˙Filing bill of costs40.(1)An application
to the taxing officer for costs to be taxed must bemade
by—(a)delivering the bill of costs to the
taxing officer for an appointmentdate for
directions; and(b)filing the bill of costs.(2)The bill of costs must be prepared in
accordance with rule 47.(3)There must be
endorsed on the back of the bill of costs a notice for anappointment for direction in schedule 1, form
512.(4)The taxing officer may direct the
party filing the bill of costs to lodgewiththetaxingofficer,beforethedateappointedfordirections,anydocumentsintheparty’spossession,custodyorpowerthatmaybeofassistance to the taxing officer on the
appointment for directions or on thetaxation.
470Rules of the Supreme Court˙Service40A.(1)Unless the taxing officer otherwise directs,
the bill of costs mustbe served not less than 14 days before
the date for hearing given in thenotice of
appointment for directions.(2)Subject to
subrule (3), the taxing officer must not tax costs unless
thebill of costs has been served on all persons
having an interest in the taxationor on the
solicitor acting for any interested person.(3)Serviceofthebillofcostsonapersonwhohasnotappearedinperson or by a solicitor or next friend
is not necessary.˙Appointment for directions41.Onthedateappointedfordirections,thetaxingofficermaygivedirections with
respect to—(a)the persons to be served with the bill
of costs; and(b)the persons who should attend or be
represented on the taxation;and(c)the content or service of any notice
of objection; and(d)the date and time of taxation of the
bill of costs; and(e)any other matter the taxing officer
considers relevant to, or wouldassist the
taxing officer on, the taxation.˙Objections to bill of costs41A.(1)Apersononwhomabillofcostsisservedmay,bynotice,object to any
item in the bill of costs.(2)A person who
intends to object must, in the notice of objection—(a)list each item in the bill of costs to
which the person objects; and(b)state specifically and concisely the grounds
and reasons for theobjection to each item.(3)The
notice of objection must be filed and served on any other
personentitled to be heard on the taxation at least
2 clear days before the date givenby the taxation
officer in the notice of appointment for directions.
471Rules of the Supreme Court(4)If—(a)no
objection is made to a bill of costs; or(b)either party fails to attend before the
taxing officer;the taxing officer may—(c)allow or disallow the amount of the costs in
the bill of costs inwhole or in part; or(d)takesuchactionregardingthetaxationasthetaxingofficerconsiders appropriate.˙Date
of entering of order to be certified42.Theofficerbywhomanyorderdirectingataxationofcosts,notbeing
an order merely directing payment of costs by one party to another,
isdrawn up, shall certify upon the order the
date on which it was entered.˙Copy
of order and statement of names etc. of parties to be left
attaxing office43.(1)The
party having the carriage of any such order, or the party’ssolicitor, shall, within 7 days, or such
further time as the taxing officer mayallow for reasons
to be certified by the taxing officer, after the order wasentered, leave at the office of the taxing
officer a copy of the order, havingannexed to it a
statement containing the names and addresses of the partiesappearing in person, and of the solicitors of
the parties not appearing inperson.(2)Nocostsofdrawingandcopyingthebillnorofattendingthetaxation, shall be allowed to a solicitor
failing to comply with this order.˙Notice
of time for leaving bills of costs to be given by taxing
master44.On the copy of the order being left
with the taxing officer, the taxingofficer shall
forthwith send by post to the parties appearing in person, and
tothe solicitors of the parties not appearing
in person, a notice fixing a datebefore which the
bill, the taxation whereof is directed by the order, shall
beleft for taxation, with all necessary papers
and vouchers, and a subsequentdate on which the
taxation shall be proceeded with.
472Rules of the Supreme Court˙Notice of adjournment of
taxation45.(1)Every taxation
shall if possible be continued without interruptiontill
completed.(2)Whenataxationisadjournedforanyreason,noticeoftheadjournment shall
be sent by the taxing officer by post to any solicitor notpresent at the time of the adjournment, whose
attendance the taxing officermay desire at the
next appointment.˙Forms of bills of costs47.(1)Billsofcostsaretobepreparedwith6separatecolumns,asfollows—(a)the
first or left-hand column for dates, specifying years,
months,and days;(b)the
second for consecutive numbers of the items;(c)the
third for the particulars of the services charged for;(d)the fourth for disbursements, ruled
for dollars and cents;(e)the fifth for
the professional charges, similarly ruled;(f)the
sixth for the taxing officer’s deductions, similarly ruled.(2)Everymoneycolumnshallbecastupbeforethebillisleftfortaxation.(3)Bills of costs as between solicitor and
client shall be prepared, and theitems therein set
out, as nearly as possible in the same manner as if the billwere
one between party and party.˙Amendment of bill48.No
addition or alteration shall be made in a bill of costs after it
islodged for taxation, except by permission or
direction of the taxing officer;and, if any such
addition or alteration is allowed on taxation of a bill of
costsbetween a solicitor and his or her client,
such addition or alteration shall notbe taken into
consideration in determining whether the bill has or has notbeen
reduced by a sixth part.
473Rules of the Supreme Court˙Bill not to be marked except by taxing
officer49.Noentry,initialling,ormarkinginabillofcostssubmittedfortaxation shall be made except by the
taxing officer personally, nor shall anyerasure be
allowed to be made therein.˙Books
etc. to be transmitted by registrar to taxing officer50.When, upon the taxation of any bill of
costs, it appears to the taxingofficer that for
the purpose of duly taxing the same it is necessary to
inspectanybooks,papers,ordocuments,relatingtothecauseormatterintheregistry, the taxing officer may
request the registrar to cause the same to betransmitted to
the taxing officer, and may also request the registrar to
certifyany proceedings in the registry which may be
comprised in the bill of costsundertaxation,andinsuchcasestheregistrarshalldirectsuchbooks,papers, and
documents, to be transmitted to the taxing officer for the
taxingofficer’s use during the taxation, and shall
certify the proceedings whichhave taken place
in the registry according to the request of the taxing
officer;and after the costs in respect of which such
request was made have beencertified,thetaxingofficershallcauseallsuchbooks,papers,anddocuments,whichhavebeensotransmittedtothetaxingofficer,tobereturned to the
registry.˙Costs of counsel settling drafts
already settled by counsel appointedby the
Court51.When in pursuance of any direction of
the Court or a Judge, the draftofanydeedorotherinstrumentissettledbycounselnominatedbytheCourt or Judge
for that purpose, the expense of procuring such draft to bepreviously or subsequently settled by other
counsel on behalf of the sameparties on whose
behalf such draft is settled by the counsel so nominated,shall
not be allowed on taxation, either as between party and party or
asbetween solicitor and client, unless the
Court or a Judge so directs.˙Gross
sum for costs—proportional part of costs52.In
any case where the Court or a Judge awards costs to a party,
theCourtorJudgemaydirecttaxationofthewholecostsofsuchpartyinrespect of the matter and payment by
the other party of a proportion thereof
474Rules of the Supreme Courtonly,
or may direct payment of a fixed sum, to be named by the Court
orJudge, in lieu of taxed costs.˙Costs where such application heard in
Court53.When a Judge directs that any matter
commenced by summons shallbe adjourned into Court, the same fees
shall, unless the Judge otherwiseorders,bepayableandthesamecostsshallbeallowedinrespectofproceedings subsequent to the adjournment as
would have been payable ifthe matter had been begun in
Court.†5. Directions as to taxation˙Application of rules54.Rules 55 to 121 shall apply to all
proceedings and all taxations in theCourt.˙Allowances for pleadings etc. in
discretion of taxing officer55.(1)The
taxing officer may, in lieu of the allowances for
instructions,andforpreparingordrawingwritsofsummonsrequiringspecialendorsement,orspecialcases,pleadings,oraffidavitsinanswertointerrogatories,affidavitsofdocuments,orotherspecialaffidavits,oradmissions of facts under order 36, rule 2,
and for attendances in respectthereof, make
such allowance for work, labour, and expenses, in or aboutthe
preparation of such documents as in the taxing officer’s discretion
thetaxing officer may think proper.(2)In this rule—“special
affidavit”includes any affidavit requiring special or
unusual careeither in its preparation or
consideration.˙Drawing pleadings56.The
fees allowed for drawing any pleading or other document
shallinclude any copy made for the use of the
solicitor, agent, or client, or forcounsel to
settle.
475Rules of the Supreme Court˙Instructions to sue or defend
etc.57.If in any case the taxing officer, on
special grounds, considers the feeprovided in
either scale for instructions to sue or defend, or the
preparationof briefs, inadequate, the taxing officer may
make such further allowance asthe taxing
officer in his or her discretion may consider reasonable.˙Swearing affidavits58.When
there are several deponents to be sworn to an affidavit, or it
isnecessary for the purpose of an affidavit
being sworn to go to a distance, orto employ an
agent, such reasonable allowance may be made as the taxingofficer in his or her discretion may think
fit.˙Drawing affidavits and attending
deponent59.The allowances for instructions and
drawing affidavits in answer tointerrogatories
and other special affidavits, and for attending the deponent
tobe sworn, include all attendances on the
deponent to settle and read over theaffidavit.˙Delivery of pleadings etc.60.Fees for delivery of pleadings,
services, and notices, are not to beallowed when the
same solicitor acts for both parties, unless it is necessaryfor
the purpose of making an affidavit of service.˙Perusals61.Fees
for perusals shall not be allowed when the same solicitor
actsfor both parties.˙Separate proceedings by the same
solicitor62.When the same solicitor is employed
for 2 or more defendants, andseparate
pleadings are delivered or other proceedings had by or for
such2ormoredefendantsseparately,thetaxingofficershallconsiderinthetaxation of such
solicitor’s bill of costs, either between party and party orbetweensolicitorandclient,whethersuchseparatepleadingsorother
476Rules of the Supreme Courtproceedings were necessary or proper, and if
the taxing officer is of opinionthatanypartofthecostsoccasionedtherebyhasbeenunnecessarilyorimproperly incurred, the same shall be
disallowed.˙Costs of joint trustees not joining in
defence63.In taxing the costs as between party
and party of joint executors ortrustees who
defend separately, the taxing officer shall, unless
otherwiseorderedbytheCourtoraJudge,allow1setofcostsonlyforsuchdefendants, which
shall be apportioned among them as the taxing officermay
deem just.˙Evidence64.Such
just and reasonable charges and expenses as appear to havebeenproperlyincurredinprocuringevidence,andtheattendanceofwitnesses, are to be allowed.˙Agency correspondence65.Incountryagencycausesandmatters,ifitisshowntothesatisfaction of
the taxing officer that the agency correspondence has beenspecial and extensive, the taxing officer may
make such special allowance inrespectthereofasinhisorherdiscretionthetaxingofficermaythinkproper.˙Drawing and settling judgments or
orders66.In the cases provided for by order 88,
rule 5, the taxing officer maymakesuchallowancesinrespectofthepreparationofthedraftofthejudgment or order by the solicitor, or
for the attendance of the solicitor onsettling the
draft, as the taxing officer may consider reasonable.˙Special allowance for attendances at
chambers in cases of difficultyetc.67.When,fromthelengthofanattendanceinchambersorintheregistry,orfromthedifficultyofthecase,theJudgethinksthefees
477Rules of the Supreme Courtspecifiedinschedule2aninsufficientremunerationfortheservicesperformed, or
when the preparation of the cause or matter in order to lay
itbefore the Judge in chambers or registrar, on
a summons or otherwise, hasrequired skill
and labour for which no fee has been allowed, the Judge mayallow
such fee, in lieu of the fees specified, as in his or her
discretion theJudge may think fit.˙Non-attendance or neglect of parties on
proceedings in chambers or inregistry68.When by reason of the non-attendance
of any party at the Judge’schambers or in
the registry, or when by reason of the neglect of any party
innot being prepared with any proper evidence,
account, or other proceeding,the attendance is
adjourned without any useful progress being made, theJudge
may order such an amount of costs (if any) as the Judge may
thinkreasonabletobepaidtothepartyattendingbythepartysoabsentorneglectful; and the party so absent or
neglectful shall not be allowed any feeas against any
other party, or against any estate or fund in which any
otherparty is interested.˙Inspection of documents under O 35, r
1469.Noallowanceshallbemadeforanynoticeorinspectionofdocuments under order 35, rule 14, unless it
is shown to the satisfaction ofthe taxing
officer that there were good and sufficient reasons for giving
suchnotice and making such inspection.˙Copies of documents, allowance of 1s 6d
(15c) per folio, except wheresolicitor refuses
production70.The party entitled to have a copy of a
document in the possession ofanotherparty,oranextracttherefrom,undertheserules,orunderanyspecial order, shall pay to the solicitor of
the party producing the documentfor such copy or
extract as the party may, by writing, require, at the rate
of1s6d(15c)perfolio;and,ifthesolicitorofthepartyproducingthedocument refuses or neglects to supply the
same, the solicitor requiring thecopy or extract
shall be at liberty to make it, and the solicitor for the
partyproducing it shall not be entitled to any fee
in respect thereof.
478Rules of the Supreme Court˙Tender for respondent’s costs on
service of petition71.(1)When a petition
in a cause or matter is served, and notice is givento
the party served that in case of the party’s appearance upon the
hearing ofthe petition, the party’s costs will be
objected to, accompanied by a tender ofcostsforperusingthesame,theamounttobetenderedshallbe£22s($4.20).(2)The
party making such payment shall be allowed the same in theparty’s costs, if the service was proper, but
not otherwise.(3)This rule is without prejudice to the
right of either party to receivecosts, or to
object to costs, when no such tender is made, or when the
Courtor Judge thinks the party entitled,
notwithstanding such notice or tender, toappear on the
hearing.(4)In any other case in which a solicitor
of a party served necessarily orproperly peruses
any such petition, without appearing on the hearing, a feenot
exceeding the amount aforesaid shall be allowed.˙Disallowance of costs of improper,
vexatious, or unnecessary matter indocuments or
proceedings72.(1)The Court or
Judge may, at the hearing of any cause or matter, oruponanyapplicationorproceedinginanycauseormatterincourtorchambers or in the registry, and whether
objection is made or not, direct thecostsofanyendorsementonawritofsummons,oranypleading,summons,
affidavit, evidence, notice requiring a statement of claim,
noticetoproduceoradmit,ortocross-examinewitnesses,oranyaccount,statement,
discovery by interrogatories or order, application for time, bill
ofcosts, service of notice of motion or
summons, or other proceeding, or anypartthereof,whichisimproper,vexatious,unnecessary,orcontainsvexatiousorunnecessarymatter,orisofunnecessarylength,orisoccasioned by
misconduct or negligence, to be disallowed, or may direct
thetaxing officer to look into the same and to
disallow the costs thereof, or ofsuchpartthereofasthetaxingofficershallfindtobeimproper,unnecessary,vexatious,ortocontainunnecessarymatter,ortobeofunnecessarylength,ortohavebeenoccasionedbymisconductornegligence; and in such case the party whose
costs are so disallowed shallpay the costs
occasioned by the proceeding to the other parties.(2)In any case in which such question has
not been raised before, and
479Rules of the Supreme Courtdealt
with by, the Court or Judge, it shall be the duty of the taxing
officer tolook into the matter, for the purpose
aforesaid, notwithstanding, in the caseof evidence, that
the same is entered as read in any judgment or order, andthereupon the same consequences shall ensue
as if the taxing officer hadbeen specially
directed to do so.˙Set-off of costs73.In
any case in which, under rule 72, or any other rule of court, or
bythe order or direction of the Court or a
Judge, or otherwise, a party entitledto receive costs
is liable to pay costs to any other party, the taxing
officermay tax the costs which such party is so
liable to pay, and may adjust thesame by way of
deduction or set-off, or may, if the taxing officer thinks
fit,delay the allowance of the costs which such
party is entitled to receive untilthe party has
paid or tendered the costs which the party is liable to pay;
orthe taxing officer may allow or certify the
costs to be paid, and may directpayment thereof;
and thereupon an order for payment shall be drawn up andsigned by the registrar, and the costs may be
recovered by the party entitledthereto in the
same manner as costs ordered to be paid by a Judge’s ordermay
be recovered.˙Notes of order as to costs of
prolixity74.WhenanyquestionastoanycostsisdealtwithbyaJudgeinchambers, the associate shall make a
note thereof, for the information of thetaxing
officer.˙Unnecessary appearance in court or at
chambers75.When any party appears upon any
application or proceeding in courtor chambers, in
which the party is not interested, or upon which, accordingto
the practice of the Court, the party ought not to attend, the party
shall notbeallowedanycostsofsuchappearance,unlesstheCourtorJudgeexpressly directs
such costs to be allowed.˙Costs of
applications to extend time76.(1)Thecostsofapplicationstoextendthetimefortakingany
480Rules of the Supreme Courtproceeding shall be in the discretion of the
taxing officer, unless the Courtor Judge has
specially directed how the costs are to be paid or borne.(2)The taxing officer shall not allow the
costs of more than 1 extensionoftime,unlessthetaxingofficerissatisfiedthatsuchextensionwasnecessary, and could not, with due
diligence have been avoided.(3)The
costs of a summons to extend time shall not be allowed,
unlessthe party taking out such summons has
previously applied to the oppositeparty to consent
to an order for a sufficient extension, and the opposite
partyhas not given such consent, or unless the
taxing officer is of opinion thatthere was good
reason for not making such application; and if the taxingofficer does not allow the costs of such
summons, and if the taxing officeris of opinion
that the party applying ought to pay the costs of any otherparty
occasioned thereby, the taxing officer may direct such payment,
andmay deal with such costs, in the manner
provided by rule 73.˙Powers of taxing
officer77.The taxing officer shall, for the
purpose of any proceeding before thetaxingofficer,havepowerandauthoritytosummonandexaminewitnesses, and to
administer oaths, and to require the production of books,papers,anddocumentsbyanyperson,andforthatpurposetodirectsubpoenas to be
issued, and to make separate certificates or allocaturs, andto
require any party to be represented by a separate solicitor, and to
do suchother acts and adopt such proceedings as may
be directed by these rules, orby the Court or a
Judge.˙Costs of taxation77A.(1)Costs to be taxed under these rules must
include the costs oftaxation.(2)Costs to be taxed under a judgment or order
must, unless otherwiseprovided, include the costs of
taxation.(3)If an offer to settle under rule 89 is
made and is not accepted—(a)if the amount
allowed by the taxing officer before determinationof
the costs of taxation is equal to, or more than, the amount
oftheoffer—thepartyliableforthecostsmustpaythecostsof
481Rules of the Supreme Courttaxation; or(b)if
the amount allowed by the taxing officer before
determinationof the costs of taxation is less than the
amount of the offer—theparty entitled to the costs must pay
the costs of taxation;unlessthetaxingofficerissatisfiedthatanotherorderisproperinthecircumstances.(4)Subject to this rule and to any order of the
Court or a Judge, thetaxingofficermaymakeorderswithrespecttothecostsoftaxation,including the
costs of the appointment for directions.(5)In
determining the costs of taxation, the taxing officer must take
intoconsideration—(a)whether the taxation has been affected by
the neglect or delay ofany person attending on the taxation;
and(b)whetheranypersonhasbeenputtounnecessaryorimproperexpense by any
other person attending on the taxation; and(c)whether, before the case and taxation are of
special difficulty andimportance and involve questions of
principle, it was necessary orproper for
counsel to appear on the taxation; and(d)all
other relevant circumstances.(6)The
taxing officer may disallow the costs of attendance on a
taxationof any person whose attendance is
unnecessary.˙Taxing officer to assist when account
comprises costs78.Whenanaccountconsistsinpartofcostswhichhavenotbeenrequired to be
taxed by an order of the Court or a Judge, or are not
requiredto be taxed by these rules, the Court or a
Judge may direct, or the registrarmay request, the
taxing officer to assist in settling such costs, and the
taxingofficer, on receiving such direction or
request, shall proceed to tax suchcosts and shall
have the same powers, and the same fees shall be payable inrespect thereof, as if the same had been
referred to the taxing officer by anorder; and the
taxing officer shall certify the result of the taxation in
thesame manner.
482Rules of the Supreme Court˙Attendance of parties on
taxation79.The taxing officer may arrange and
direct what parties are to attendbefore the taxing
officer on the taxation of costs to be borne by an estate orfund,
and may disallow the costs of any party whose attendance the
taxingofficer may in his or her discretion consider
unnecessary in consequence ofthe interest of
such party in such fund or estate being small or remote, oradequatelyprotectedbyotherpartiesinterested,orforothersufficientreason.˙Refusal or neglect to procure
taxation80.When 1 of several parties entitled to
costs refuses or neglects to bringin his or her
costs for taxation, or to procure the same to be taxed, andthereby prejudices any other party, the
taxing officer may proceed to tax thecosts of the
other parties, and may certify such refusal or neglect, and
theother parties may, by leave of the Court or a
Judge, proceed as if the costsof the party so
refusing or neglecting had been allowed at a nominal or
othersum, so as to prevent any other party from
being prejudiced by such refusalor
neglect.˙Costs between party and party81.Costswhichdonotappeartothetaxingofficertohavebeennecessaryorproperfortheattainmentofjustice,orformaintainingordefending the rights of the party, or which
appear to the taxing officer tohave been
incurred through over-caution, negligence, or mistake, or
merelyat the desire of the party, shall not be
allowed to any party, to be paid orborne by another
party.˙Costs as between solicitor and
client82.(1)Onthetaxationofcostsasbetweensolicitorandclient,costswhichdonotappeartothetaxingofficertohavebeennecessarilyorproperly incurred by the solicitor for the
attainment of justice or protectingthe rights of the
party, or which appear to have been incurred improvidently,or
through over caution, negligence, or mistake, on the part of the
solicitor,shall not be allowed.(2)On
the taxation as between solicitor and client of costs of
proceedings
483Rules of the Supreme Courtin
court, the taxing officer may allow reasonable charges for work or
outlayproperlydoneormade,notwithstandingthatsuchchargesarenotrecoverable from
any other party, or have been disallowed in taxation inwhole
or part as between party and party, unless, in any case, the
taxingofficerisofopinionthattheconsentoftheclientoughttohavebeenobtained before the charge was incurred, in
which case no allowance shallbe made in
respect thereof unless it is shown to his or her satisfaction
thatthe charge was incurred with the consent or
with the subsequent approval ofthe
client.(3)The taxing officer’s allowance or
disallowance, in whole or in part, ofany costs taxed
under this rule shall be subject to review, as in other
cases.(4)If, during the taxation of a bill of
costs, or the taking of an account,between solicitor
and client, it appears to the taxing officer that there must
inany event be moneys due from the solicitor to
the client, the taxing officermayfromtimetotimemakeaninterimcertificateastotheamountsopayable by the solicitor.(5)Upon the filing of such certificate
the Court or a Judge may order themoneys so
certified to be forthwith paid to the client or brought into
court.˙General power of allowance82A.Subjecttorules81and82thetaxingofficershall,oneverytaxation, allow
all such costs, charges, and expenses as shall appear to thetaxing officer to have been necessary or
proper for the attainment of justiceor for defending
the rights of the party whose costs are to be taxed.˙Inclusion in bill of disbursements due
but not paid82B.(1)IntaxationsunderorpursuanttotheCostsAct1867ofasolicitor’s bill of costs, whether on
the application of the solicitor or theparty to be
charged with the bill or any other person, the taxing officer
mayallow disbursements (including counsel’s
fees)—(a)which have been actually made before
the delivery of the bill; or(b)notwithstanding that they have not been made
before the deliveryof the bill, provided that they were made in
respect of a liabilityproperlyincurredbythesolicitoronbehalfofthepartytobe
484Rules of the Supreme Courtcharged with the bill, and that they are
described in the bill as notthen made, and
that they have been made before the taxation iscompleted.(2)For
the purposes of the computation of1/6thereof any such
bill shallbe deemed to include such unpaid
disbursements as part of the bill.(3)The
provisions as to the review of taxations shall apply to
anythingdone by the taxing officer pursuant to this
rule.˙Solicitor trustee83.(1)On
the taxation of a bill of costs between a solicitor who is
anexecutorortrusteeandhisorherbeneficiary,nocostsotherthancostsout-of-pocketshallbeallowedinrespectofanyprofessionalservicesrendered by the solicitor, either in the
administration of the trust estate out ofcourt, or in
respect of a cause or matter concerning the trust estate to
whichthe solicitor is a party, unless the
solicitor is specially authorised to makesuch charges by
the instrument creating the trust.(2)But
such solicitor may employ as his or her solicitor for the
purposesof the trust a member of a firm of which the
solicitor is himself or herself apartner; and a
partner so employed may be allowed the usual professionalcharges, provided that the solicitor trustee
does not participate in the profits,and that a
certificate to that effect, signed by the solicitor trustee, is
producedon the taxation.˙Solicitor mortgagee84.A
solicitor in whose favour, either alone or jointly with any
otherperson, a mortgage or charge on any property
is made, and any firm ofsolicitors of which such mortgagee
solicitor is a member, shall be entitled tocharge and
receive for all professional business transacted by such
solicitororfirmininvestigatingthetitle,andinpreparingandcompletingthemortgage or charge, such and the same costs,
charges, and remuneration, ashe, she or they
would be entitled to receive if such mortgage or charge hadbeen
made to a person not a solicitor, and the mortgagee had retained
andemployedsuchsolicitororfirmtotransactsuchbusinessashisorhersolicitororsolicitors;andsuchchargesandremunerationshallberecoverable from the mortgagor or
person giving the charge accordingly.
485Rules of the Supreme Court˙Fees not specially provided for85.When any services are necessarily and
properly performed for whichno specific
allowance is provided in schedule 2, but which is of the
samenature as services for which allowances are
provided, the taxing officer mayinhisorherdiscretionallowforsuchservicesfeessimilartothosespecified in
schedule 2 for services of like nature.˙Costs
of amendment of plaintiff’s pleadings86.When
a plaintiff is directed to pay to a defendant the costs of
thecause,thecostsoccasionedtothedefendantbyanyamendmentoftheplaintiff’s pleadings shall be deemed
to be part of such defendant’s costs inthe cause, except
as to any amendment which was rendered necessary bythe
default of such defendant; but there shall be deducted from such
costsany sum which may have been already paid by
the plaintiff in respect ofsuch
amendment.˙Plaintiff refused costs of his or her
amendments87.When, upon the taxation of the costs
of a plaintiff who has obtained ajudgmentwithcosts,thecostsofanyamendmentoftheplaintiff’spleadingsaredisallowedonthegroundofthesamehavingbeenunnecessary, the
defendant’s costs occasioned by such amendment shall betaxed, and the amount thereof shall be
deducted from the costs to be paid bythe defendant to
the plaintiff.˙Taxation when cause dismissed with
costs88.When a cause is dismissed with costs,
or a motion is refused withcosts, or any
costs are by any general or special order directed to be
paid,the taxing officer may tax such costs without
any order referring the samefor taxation,
unless the Court or a Judge otherwise directs.˙Offer
to settle costs89.(1)A person liable
to pay costs may serve an offer to settle on theparty
entitled to the costs.
486Rules of the Supreme Court(2)An offer to settle—(a)must—(i)be
in writing; and(ii)include a
statement that it is made under this rule; and(iii)be
made in respect of the whole of that person’s liability forcosts; and(b)may
be served—(i)in the case of costs not payable under
a judgment or order orotherwise under these rules—at any
time after the liabilityfor costs accrues (but not less than 7
days before the dayappointed for directions by the taxing
officer); or(ii)in any other
case—at any time after the judgment or orderfor costs is
made.(3)An offer to settle—(a)cannot be withdrawn without the leave
of the Court or a Judge;and(b)does
not lapse because of rejection or failure to be accepted;
and(c)expires at the start of taxation of
the bill of costs to which theoffer
relates.(4)Except for the purpose of subrule (6),
the making of an offer to settlemust not be
disclosed to the taxing officer until the costs of taxation are
tobe determined.(5)The
acceptance of an offer to settle must be in writing.(6)On being satisfied that the offer to
settle has been accepted, the taxingofficer must
certify that the costs have been fixed at the amount of the
offer.˙When total of costs taxed to be
stated90.When any costs are by any judgment or
order directed to be taxedand to be paid out of any money or fund
in court, the taxing officer shall, inthe taxing
officer’s certificate of taxation, without any direction for
thatpurpose in such judgment or order, state the
total amount of all such costsas
taxed.
487Rules of the Supreme Court˙Considerations by which taxing
officer’s discretion must beinfluenced91.(1)Fees or
allowances which are discretionary shall, unless otherwiseprovided,beallowedatthediscretionofthetaxingofficer,who,intheexercise of such discretion, shall take
into consideration the other fees andallowances to the
solicitor and counsel (if any) in respect of the work towhich
any such allowance applies, the nature and importance of the cause
ormatter, the amount involved, the interest of
the parties, the persons, estate,orfund,bywhomorbywhichthecostsaretobeborne,thegeneralconduct and costs
of the proceedings, and all other circumstances.(2)When a party is entitled to sign
judgment for costs, the taxing officer,in taxing the
costs, may allow a fixed sum for the costs of the judgment.˙Power to taxing officer to assess costs
at a gross sum in case of delayor improper
conduct of litigation92.(1)If in any case
in which a taxation is directed the costs have beenincreased by unnecessary delay, or by
improper, vexatious, or unnecessaryproceedings, or
by other misconduct or negligence, or if from any othercause
the amount of the costs is excessive having regard to the value of
theestate,fund,orassetstowhichtheyrelate,orothercircumstances,thetaxing officer shall allow only such an
amount of costs as would have beenincurred if the
litigation had been properly conducted, and shall assess thesameatagrosssum,andshall,ifnecessary,apportiontheamountsoallowed among the parties.(2)The provisions as to the review of
taxations shall apply to allowancesand certificates
under this rule.˙Disallowances when bill reduced by a
sixth93.If, on the taxation of a bill of costs
payable out of an estate or a fund,oroutoftheassetsofacompanyinliquidation,theamountoftheprofessional charges contained in the
bill is reduced by a sixth part, no costsshall be allowed
to the solicitor leaving the bill for taxation for drawing
andcopying it, nor for attending the
taxation.
488Rules of the Supreme Court˙Premature delivery of briefs94.When a cause or matter is not brought
on for trial or hearing, thecosts of and
consequent on the preparation and delivery of briefs shall
notbeallowed,ifthetaxingofficerisofopinionthatsuchcostswereprematurely incurred.˙Defendant’s costs, when trial comes on but
action cannot be tried95.Whenacausewhichstandsfortrialiscalledontobetried,butcannotbedecidedbyreasonofwantofpartiesorotherdefectintheproceedingsoccasionedbytheerrorordefaultoftheplaintiff,andistherefore struck out of the paper, and
the same cause is again set down, thedefendant shall
be allowed the taxed costs occasioned by the first settingdown,althoughthedefendantdoesnotobtainthecostsofthecauseormatter.˙Delivery of bill to client, when costs to be
paid out of a fund97.When in any cause or matter any bill
of costs is directed to be taxedfor the purpose
of being paid or raised out of any estate or fund, the
taxingofficer may require the solicitor to deliver
or send to the solicitor’s clients,or any of them,
free of charge, a copy of such bill, or any part thereof,previously to such officer completing the
taxation thereof, accompanied byany statement
which the taxing officer may direct, and by a letter
informingsuch client that the bill of costs has been
referred to the taxing officer fortaxation,andwillbeproceededwithatthetimethetaxingofficerhasappointedforthispurpose,andinanysuchcasethetaxingofficermaysuspendthetaxationforsuchtimeasthetaxingofficermayconsiderreasonable.˙Proof
of payment98.Except in the case of counsel’s fees,
no costs shall be allowed ontaxation in
respect of sums payable or paid to persons other than the
partywhosecostsarebeingtaxed,ortheparty’ssolicitor,exceptuponanaffidavit that such sums have been actually
paid, or upon a consent orderthat the amount
thereof shall be paid into court, to abide the order of theCourt.
489Rules of the Supreme Court˙Power of taxing officer to limit or
extend time99.(1)The taxing
officer shall have power to limit or extend the time forany
proceeding before the taxing officer; and, when by any rules of
court, orany order of the Court or a Judge, a time is
appointed for any proceedingbefore or by the
taxing officer, the taxing officer shall, unless the Court
orJudge otherwise directs, have power from time
to time to extend the timeappointed, upon such terms (if any) as
the justice of the case may require,and although the
application for the extension is not made until after theexpiration of the time appointed.(2)Itshallnotbenecessarytomakeanycertificateororderforthepurpose of any such extension, unless
the same is required for any specialpurpose.˙Witnesses’ expenses100.(1)The
affidavit as to witnesses’ expenses must state the place ofabode,andthecondition,quality,occupation,orrankinlife,ofthewitnesses or intended witnesses charged
for; the places at which they weresubpoenaed, and
the distances which they had to travel for the purpose ofattending the trial; and whether, to the
knowledge or belief of the deponent,theyattendedaswitnessesinanyothercause,orcameuponanyotherbusiness;andshallalsostatethattheywerematerialandnecessarywitnesses for the
party on the trial of the cause.(2)The
affidavit shall also state the day for which notice of trial
wasgiven, the day appointed, the day or days on
which the cause was tried, andthenumberofdaysduringwhichthewitnesseswerenecessarilyabsentfrom
home for the purpose of the trial, in going, remaining, and
returning.(3)When witnesses are paid separately, it
must be made to appear clearlyhowmuchhasbeenpaidtoeach;andiftheyhavebeenpaidpartlybyseparate payments to themselves, and partly
by discharging their railway orair fare or car
hire, hotel bills, or the like, it should be shown how much
ofsuch joint expenses may fairly be allocated
to each person.(4)Whenthewitnessesarenumerous,thepaymentsandotherparticulars above
required shall be stated by way of schedule to the
affidavit;the schedule shall be drawn with clearness
and precision, and the affidavitmust fully verify
it.
490Rules of the Supreme Court(5)Every such affidavit shall be made by
the solicitor or person actuallymaking the
payments, and not on information and belief.˙Direction as to documents on taxation101.(1)An index or
schedule of the documents included in each brief,with
the number of folios in each and the pages of the brief on which
thesame are respectively copied, shall be
endorsed on such brief, or annexedthereto, and
shall be left with the taxing officer together with each brief
atthe time of obtaining the appointment for the
taxation.(2)All orders, reports, and other
important documents shall be producedon
taxation.(3)All drafts and other documents, the
preparation whereof is chargedfor by the folio,
shall be produced at the time of taxation, and the foliosthereof shall, if required by the taxing
officer, be numbered consecutively inthe margin, and
the number of the folios endorsed thereon in figures.(4)The length of all documents not
vouched by attested copies or othersatisfactory
evidence shall be certified by the solicitor, and, if such
certificateis erroneous, the taxing officer may disallow
the costs of the document soerroneously
certified or any part thereof.˙Endorsement on bill of costs102.(1)Every bill of
costs left for taxation shall be endorsed with thename
and address of the solicitor by whom it is left, and also the name
andaddress of the solicitor (if any) for whom
the solicitor is agent.(2)The name of
every solicitor who is entitled or intended to participatein
the costs to be so taxed shall be added.˙Copies
of bills of costs103.Copiesofbillsofcostsshallbemadepageforpage,soastocorrespond with
the bill left for taxation.
491Rules of the Supreme Court˙Folio to be 72 words104.A folio
comprises 72 words, every figure comprised in a column,or
authorised to be used, being counted as 1 word.†6.
Fees to counsel and other professional persons˙Retaining fees105.On
taxation as between party and party, a retaining fee shall not
beallowed to more than 1 counsel.˙Fees to counsel for settling pleadings,
affidavits etc. and advisingthereon106.Suchcostsofprocuringtheadviceofcounselonthepleadings,evidence, and
proceedings, in any cause or matter as the taxing officer
mayin the taxing officer’s discretion think just
and reasonable, and of procuringcounsel to settle
such pleadings and special affidavits as the taxing officermay
in the taxing officer’s discretion think proper to be settled by
counsel,are to be allowed; but as to affidavits a
separate fee is not to be allowed foreach affidavit,
but 1 fee shall be allowed for all the affidavits proper to be
sosettled, which are or ought to be filed at
the same time.˙Fees for conferences107.Fees for
conferences with counsel shall not be allowed in any causeor
matter in addition to the solicitor’s and counsel’s fees for
drawing andsettling, or perusing any pleadings,
affidavits, deeds, or other proceedingsor abstracts of
title, or for advising thereon, unless it appears to the
taxingofficer that for some special reason a
conference was necessary or proper.˙Counsel108.In
cases in which the costs of employing 2 or more counsel mayproperly be allowed, such allowance may be
made although neither of suchcounsel is one of
Her Majesty’s counsel.
492Rules of the Supreme Court˙Consultations109.In
cases in which the costs of employing 2 or more counsel mayproperlybeallowed,thetaxingofficermay,inthetaxingofficer’sdiscretion, allow the costs of consultations
between them.˙Refresher fees110.Whenthetrialorhearingofanycauseormatterincourtorchambers extends beyond the day in which it
is begun, the taxing officermay allow
refresher fees to counsel for every day subsequent to that
onwhich the trial or hearing began.˙Counsel in registry111.The
costs of counsel attending in the registry shall not be allowed
inanycaseunlesstheJudgecertifiesorthetaxingofficeratBrisbane,Rockhampton,
Townsville or Cairns considers it to be a proper case for
theattendance of counsel.˙Vouchers for counsel’s fees112.No fee to
counsel shall be allowed on taxation unless it is vouchedby
his or her signature, or payment thereof is proved by
affidavit.˙Fees of counsel nominated by the Court,
accountants etc.114.The allowances
in respect of fees to counsel nominated by the Courttosettledraftsofdeedsorotherinterests,andtoanyaccountants,merchants,
engineers, actuaries, and other scientific persons to whom
anyquestionisreferred,shallberegulatedbythetaxingofficer,subjecttoappeal to a Judge, whose decision shall be
final.˙Previous costs115.The
taxing officer, in taxing any subsequent costs in the same
causeor matter, shall have regard to the preceding
bills, so as to ascertain thatnone of the items
charged were included in any previous bill.
493Rules of the Supreme Court†7. Certificate and review˙Allocatur116.(1)When
the taxation is concluded, the taxing officer shall state
theresult thereof either in the form of an
allocatur written on the bill of costs orin the form of a
certificate, as the case may require.(2)Such
certificate shall be prepared without interlineation or
alteration,save such as the taxing officer may think it
right to mark with the taxingofficer’s
initials, and no erasure shall be allowed.(3)Thetaxingofficermayneverthelessmakefromtimetotimeaninterim allocatur or certificate, or interim
allocaturs or certificates, in respectofanyportionorportionsofthebillofcosts,withoutwaitingfortheconclusion of the taxation.˙Objections to taxation—review117.(1)Any party who is
dissatisfied with the allowance or disallowanceby the taxing
officer, in any bill of costs taxed by the taxing officer, of
thewhole or any part of any items, may, at any
time before the certificate orallocaturissigned,orsuchearliertimeasmaybefixedbythetaxingofficer, deliver to the other party
interested therein, and leave with the taxingofficer,anobjectioninwritingtosuchallowanceordisallowance,specifying
therein by a list, in a short and concise form, the items or
partsthereof objected to, and the grounds and
reasons for such objections, andmay thereupon
apply to the taxing officer to review the taxation in respect
ofthe same.(2)The
taxing officer may, pending the consideration and
determinationofanysuchobjection,signacertificateorallocaturinrespectoftheremainderofthebillofcostsoranypartthereof,andafterthetaxingofficer’s
decision upon the objections shall sign such further certificate
orallocatur as may be necessary.˙Review of taxation by taxing
officer118.(1)Uponsuchapplicationthetaxingofficershallreconsiderandreview his or her taxation upon such
objections, and the taxing officer may,
494Rules of the Supreme Courtif
the taxing officer thinks fit, receive further evidence in respect
thereof,and, if so required by either party, the
taxing officer shall state either in hisor her
certificate of taxation or allocatur, or by reference to such
objection,the grounds and reasons of the taxing
officer’s decision thereon, and anyspecial facts or
circumstances relating thereto.(2)Exceptasprovidedbythisrule,thetaxingofficershallnotbeatliberty,afterthecertificateorallocaturissigned,toreviewhisorhertaxationoramendhisorhercertificate,excepttocorrectaclericalormanifest error before payment or process
issued for recovery of the costs.˙Review
of taxing officer’s decision by Judge119.Any
party who is dissatisfied with the certificate or allocatur of
thetaxing officer as to any item or part of an
item which has been objected to asaforesaid, may
within 14 days from the date of the certificate or allocatur,
orsuch other time as the Court or a Judge, or
the taxing officer at the timewhen the taxing
officer signs his or her certificate or allocatur, may
allow,apply to a Judge at chambers for an order to
review the taxation as to thesameitemorpartofanitem,andtheJudgemaythereuponmakesuchorderastheJudgemaythinkjust;butthecertificateorallocaturofthetaxing officer shall be final and
conclusive as to all matters which shall nothave been
objected to in manner aforesaid.˙Evidence on review120.Unless the Judge otherwise directs, every
such application shall beheard and determined by the Judge upon
the evidence which was before thetaxing officer,
and no further evidence shall be received upon the hearingthereof without such direction.˙Note about taxation of costs121.(1)After costs have
been taxed, a note about the taxation may beattached to the
judgment or order in the case.(2)If
the note is attached, it must be in schedule 1, form
513.
495Rules of the Supreme Court†ORDER 92—SITTINGS AND VACATIONS˙Court of Appeal1.(1)Sittings of the Court of Appeal shall be
held in each year on days tobeappointedforthatyear,andonsuchotherdaysasmaybespeciallyappointed from
time to time by the Judges.(2)Any act or
proceeding which by any statute or practice is required tobe
done or taken in or with reference to terms, shall be done or taken
in orwith reference to the sittings of the Court
of Appeal annually appointed asaforesaid.˙Sittings before single Judges2.SittingsoftheCourtbeforeasingleJudgeshall,ifthereisanybusiness to be transacted and subject
to the Judge being available to sit, beheld in each year
on days to be appointed for that year, and on such otherdays
as the Judge may think fit to sit in court.˙Vacations5.There shall be 2 vacations in each year, a
winter vacation of 2 weeks,beginningonadayinJulyorAugusttobeappointedannuallybytheJudges,andasummervacationof6weeks,beginningonadayinDecember, to be appointed annually in
like manner.˙Holidays6.(1)The
following days shall be observed as holidays of the Court,
thatistosay:NewYear’sDay,GoodFriday,EasterEve,EasterMonday,ChristmasDay,thedaysfollowingChristmasDayuptoandincludingNew Year’s Eve,
the birthday of the Sovereign, and such other days as maybe
appointed by rules of court from time to time and by theHolidays Act1983.(2)However, if in
any year any day other than the actual birthday of theSovereign is observed as a public holiday
under theHolidays Act 1983inhonour of the Sovereign then such public
holiday shall be observed as a
496Rules of the Supreme Courtholiday of the Court instead of the actual
birthday of the Sovereign and theseveral offices
of the Court shall be closed on such public holiday and noton
the actual birthday of the Sovereign.(3)Inaddition,whenadayhasbeenappointedaholidayundertheHolidaysAct1983,allbusinesssetdowntobeheardincourtorinchambers on that day, will, unless
otherwise ordered, be taken and heard onthe day next
following on which the Court or a Judge in chambers sits tohear
such business.˙Office hours7.(1)The
several offices of the Court shall be open on every day in
theyear except Saturdays and Sundays and Court
holidays, and shall be openfrom 9 a.m. until
4 p.m.(2)However, when the time for doing any
act or taking any proceedingorfilinganydocumentinorattheofficesoftheCourtexpiresonaSaturday and by
reason thereof the act or proceeding cannot be done ortaken
or the filing made on that day, the act or proceeding or filing
shall, sofar as regards the time of doing or taking it
or making the filing, be held tobe duly done or
taken or made if done or taken or made on the next day onwhich
the offices of the Court are open.˙Vacation Judges8.AnyJudgemaysitinvacationforanother,andmayinvacationexercise any authority which any other Judge
might exercise if the otherJudge were
present and sitting in court or chambers.
497Rules of the Supreme Court†ORDER 93—GENERAL PROVISIONS†1. Notices, printing, paper, copies,
office copies etc.˙All notices to be in writing1.All notices required by these rules
shall be in writing, unless expresslyauthorised by the
Court or a Judge to be given orally.˙Form
of documents2.(1)All proceedings,
accounts, and copies, filed in the registry, shall bewrittenorprinteduponpaperofthesizeknownasInternationalPaperSize
A4, that is to say, measuring approximately 298 mm by 210 mm
ofgood and durable quality and capable of
receiving ink writing, bookwise,withaquartermargin,unlessthenatureofthedocumentrendersitimpracticable to do so.(2)Everydocumentintendedtobefiledshallbelegiblyandcleanlywrittenorprinted,withoutblotting,orerasure,andwithoutanysuchalteration as to
cause material disfigurement.(3)The
registrar may refuse to file any document which contravenes
theprovisions of this rule, and the taxing
officer may disallow the costs of anysuch
document.˙Regulations as to printing and printed
copies3.Thefollowingregulationshallbeobservedwithrespecttoprinteddocuments—(a)the document shall be printed upon
paper of the size and qualityas defined in
rule 2, or similar paper, in pica type leaded, with aninnermarginabout19mmwide,andanoutermarginabout63 mm
wide;(b)the document shall be printed by the
party on whose behalf it isfiled;(c)to enable the party printing to print
any document already filed,
498Rules of the Supreme Courtthe
registrar shall on demand deliver to such party a copy
writtenon draft paper on 1 side only;(d)thepartyprintingshall,ondemandinwriting,furnishtoanyother party any
number of printed copies, not exceeding 10, uponpayment therefor at the rate prescribed in
schedule 3 for officecopies;(e)as
between a solicitor delivering any printed copies and his or
herclient, credit shall be given by the
solicitor for the whole amountpayable by any
other party for such printed copies;(f)a
party entitled to be furnished with a print shall not be
allowedanychargeinrespectofawrittencopy,unlesstheCourtoraJudge so directs;(g)when,byanyorderoftheCourtoraJudge,anydocumentisordered to be printed, the Court or Judge
may order the expenseofprintingtobeborneandallowed,andprintedcopiestobefurnished, by
and to such parties and upon such terms as may bejust.˙Affidavits printed or written4.Affidavits may be either in print or
in manuscript, or partly in printand partly in
manuscript.˙Copies of affidavits5.Any party may demand from any other
party a copy of any affidavitwhich is not
printed, and which has been filed by such other party, or isreferred to in a list of affidavits served by
the party.˙Copies of documents not printed6.The following rules shall be observed
with respect to copies—(a)when any party
is entitled to a copy of any document filed orprepared by or
on behalf of another party which is not printed,such
copy shall be furnished by the party by or on whose behalfthe
same has been filed or prepared;
499Rules of the Supreme Court(b)the party requiring any such copy, or
the party’s solicitor, shallmake written
application to the party by whom the copy is to befurnished, or the party’s solicitor, with an
undertaking to pay theproper charges, and thereupon such
copy is to be made and readyto be delivered
at the expiration of 24 hours after the receipt ofsuch
request and undertaking, or within such other time as theCourt or a Judge may in any case direct, and
is to be furnishedaccordingly upon demand and payment of the
proper charges;(c)in the case of an ex parte application
of an injunction or writ ofcapias ad
respondendum, the party making such application is tofurnishcopiesoftheaffidavitsuponwhichitisgranteduponpayment of the proper charges immediately
upon the receipt ofsuch written request and undertaking as
aforesaid, or within suchtimeasmaybespecifiedinsuchrequest,ormayhavebeendirected by the
Court or a Judge;(d)the note at the foot of every
affidavit filed stating on whose behalfit is so filed
shall be printed on every printed copy of the affidavit,and
copied on every office copy and copy furnished to a party;(e)the name and address of the party or
solicitor by whom any copyisfurnishedshallbeendorsedthereoninlikemannerasuponproceedingsincourt,andsuchpartyorsolicitorshallbeanswerable for the same being a true
copy of the original, or of anoffice copy of
the original, of which it purports to be a copy, asthe
case may be;(f)the folios of all printed and written
office copies, and of copiesdelivered or
furnished to a party, shall be numbered consecutivelyin
the margin thereof, and such written copies shall be written in
aneatandlegiblemanneronthesamepaperasinthecaseofprinted copies;(g)ifanypartyorsolicitorwhoisrequiredtofurnishanysuchwritten copy as
aforesaid refuses, or, for 24 hours from the timewhen
the application for such copy has been made, neglects, tofurnish the same, the party by whom such
application is madeshall be at liberty to procure an office
copy from the registry, andin such case no
costs shall be payable to the solicitor so makingdefault in respect of the copy so applied
for, unless the Court or aJudge so directs.
500Rules of the Supreme Court†2. Service˙Personal service7.When
any document is required to be served personally, service
shall,unless otherwise provided by these rules, be
effected by delivering to thepersontobeservedacopyofthedocumenttobeserved,and,ifthatdocumentisnottheoriginaldocument,atthesametimeshowingtheperson the original, if the person so
requires, or by delivering to him anoffice copy of
the document to be served.˙Substituted
service8.(1)In any case in
which personal service of any document is requiredby
these rules or otherwise, if it is made to appear to the Court or a
Judgethat prompt personal service cannot be
effected, the Court or Judge maymake such order
for substituted or other service, or for the substitution ofnotice for service by letter, public
advertisement, or otherwise, as may bejust.(2)Service so effected in accordance with
any such order shall have thesame operation as
personal service.˙Service of judgments and orders9.(1)Subject to order
53, rule 3, when it is intended to enforce obedienceto a
judgment or order by process of attachment, the judgment or
ordermust be served personally upon the person
against whom such process is tobe sought.(2)Except as aforesaid, personal service
of a judgment or order shall notbe necessary, nor
need the original be shown unless required by the partyserved.˙Mode
and time of service when not personal10.Any
document of which personal service is not prescribed by
statuteor by these rules shall be sufficiently
served if left within the prescribedhours(ifany)attheaddressforserviceofthepersontobeservedas
501Rules of the Supreme Courtdefined by these rules with any person
resident at or belonging to such placeor if posted in a
prepaid envelope addressed to the person to be served atsuch
address as aforesaid; provided that where service under this rule
ismade by post, the time at which the document
so posted would be deliveredin the ordinary
course of post shall be considered as the time of servicethereof.˙Service of notices from Court11.Notices sent from any office of the
Court may be sent by post; andthe time at which
the notice so posted would be delivered in the ordinarycourse of post shall be considered as the
time of service thereof, and theposting thereof
shall be a sufficient service.˙Service when no appearance or no address for
service12.(1)When no
appearance has been entered for a party, or when a partyor
the party’s solicitor, as the case may be, has omitted to give an
addressfor service as required by these rules, all
documents in respect of whichpersonal service
is not prescribed by statute or by these rules may be servedby
filing them in the registry.(2)Any
document so filed shall be stuck up in the registry, and
shallremain so stuck up for 14 days.˙Service upon solicitor of party
formerly appearing in person13.Whenapartyafterhavingsuedorappearedinpersonhasgivennoticeinwritingtotheoppositepartyortheoppositeparty’ssolicitor,through a
solicitor, that such solicitor is authorised to act in the cause
ormatter on his or her behalf, all documents
which ought to be delivered to orserved upon the
party on whose behalf the notice is given shall thereafter
bedelivered to or served upon such solicitor at
the address given in the notice.˙Service upon town solicitor of person not a
party14.When a person who is not a party
appears in any cause or matter,either before the
Court or in chambers, service upon the town solicitor
by
502Rules of the Supreme Courtwhom
such person appears, whether such solicitor act as principal or
agent,shall be deemed good service except in
matters requiring personal service.˙Service not to be effected on Good Friday or
Christmas Day15.Noinstrument,exceptawarrantinanadmiraltyaction,shallbeserved on Good Friday or Christmas
Day.˙Affidavits of service16.Affidavits of service shall state the
time when, the place where, theperson by whom,
and the manner in which, the service was effected.†3. Effect of noncompliance˙Noncompliance with rules17.(1)Where, in
beginning or purporting to begin any proceedings or atany
stage in the course of or in connection with any proceedings, there
has,by reason of anything done or left undone,
been a failure to comply with therequirements of
these rules, whether in respect of time, place, manner, formorcontentorinanyotherrespect,thefailureshallbetreatedasanirregularityandshallnotnullifytheproceedings,anysteptakenintheproceedings, or
any document, judgment or order therein.(2)Subject to subrule (3), the Court or a Judge
may, on the ground thattherehasbeensuchfailureasismentionedinsubrule(1),andonsuchterms
as to costs or otherwise as the Court or a Judge thinks just, set
asideeither wholly or in part the proceedings in
which the failure occurred, anystep taken in
those proceedings or any document, judgment or order thereinor
exercise the powers under these rules to allow such amendments (if
any)to be made and to make such order (if any)
dealing with the proceedingsgenerally as the
Court or a Judge thinks fit.(3)The
Court or a Judge shall not wholly set aside any proceedings
orthewritorotheroriginatingprocessbywhichtheywerebegunontheground that the
proceedings were required by any of these rules to be begunby an
originating process other than the one employed.
503Rules of the Supreme Court˙Application to set aside for
irregularity, when allowed18.An application
to set aside for irregularity any proceedings, any steptaken
in any proceedings or any document, judgment or order therein
shallnot be allowed unless it is made within a
reasonable time, nor if the partyapplying has
taken any fresh step after knowledge of the irregularity.˙Objections for irregularity19.When an application is made to set
aside proceedings for irregularity,the several
objections intended to be insisted upon shall be stated in
thenotice of motion or summons.˙Costs20.When
a summons is taken out to set aside any process or
proceedingfor irregularity with costs, and the summons
is dismissed generally withoutany special
direction as to costs, the order dismissing the summons shall
bedrawn up including an order that the
applicant pay the costs thereof.†4.
General˙Repealed orders not revived21.No order or rule repealed by any
former order or rule of court shallbe revived by any
of these rules unless expressly so declared.˙Practice where not prescribed22.(1)When any party
desires to take any step in a cause or matter andthe
manner or form of procedure is not prescribed by these rules, the
partymayapplytotheCourtoraJudgefordirectionsandanysteptakeninaccordancewithsuchdirectionsshallbedeemedtoberegularandsufficient.(2)The
Court or a Judge, in giving such directions, shall have regard
tothe procedure and practice observed at the
time of the coming into operationof theRules of the Supreme Court 1900.
504Rules of the Supreme Court˙Testing of writs and commissions23.(1)AllwritsandcommissionsissuedfromtheCourt,andalldocuments issued under the Great Seal
of the Court, shall, unless by anystatute or by
these rules it is otherwise provided, bear date on the day
onwhich they are issued.(2)Allwritsandcommissionsshallbetestedinthesamemanneraswrits of summons in actions.˙Solicitor to act for party24.Whenever by these rules any act is
required to be done by, or to, orwith reference
to, a party, then, in the case of a party who sues or
appearsby solicitor, such act shall be done by, or
to, or with reference to, suchsolicitor, unless
it is expressly provided that it shall be done by, or to, orwith
reference to, the party in person.˙Publication of reasons25.When
any judgment is pronounced in any cause or matter either by
aCourt of Appeal or a single Judge and the
opinion of any Judge is reducedtowritingitshallbesufficienttostateorallytheopinionoftheJudgewithout stating
the reasons therefor but the Judge’s written opinion shall
bethen published by delivering the same to the
registrar or associate in opencourt.†ORDER 94—FORMS—FEES˙Forms1.The
several forms in schedule 1 shall be used for the several
purposestowhichtheyarerespectivelyapplicable,withsuchvariationsascircumstances may require.
505Rules of the Supreme Court˙Fees2.The
fees and percentages to be taken in the several offices of the
Court,and by the several officers thereof, shall be
as set forth in schedule 3.˙No
fees payable by Crown or out of the Consolidated Fund3.Notwithstanding anything to the
contrary in these rules contained, inanyproceedingsinwhichHerMajesty,oranypersononbehalfoftheCrown,oranydepartment,corporation,orinstrumentalitywhoseexpenditure is appropriated or drawn from the
Consolidated Fund, or anyperson on behalf of any such
department, corporation, or instrumentality, isa party, no fees
of court need be prepaid on behalf of Her Majesty, or thesaid
department, corporation, instrumentality, or person, but such fees
maynevertheless be recoverable from the opposite
party with costs, if judgmentis given against
such party.†ORDER 95—DISTRICT REGISTRIES˙Proceedings in district
registries1.(1)Subject to the
rules hereinafter set forth, all civil causes and mattersmay
be commenced in a district registry.2(2)Subject to theSupreme Court
Act 1995, part 19 and any rule of court,all
applications and other proceedings in any such cause or matter
shall bemade and carried on in such registry, and
such cause or matter shall be triedor heard in the
district for which such registry has been constituted.˙Application of these rules2.This order shall apply to all such
causes and matters.2For the definition “district
registry”, see order 1, rule 1.
506Rules of the Supreme Court˙District where action to be
commenced3.The district in which an action shall
be commenced shall be—(a)thedistrictwithinwhichthedefendant,or1of2ormoredefendants, as
the case may be, reside or carries on business; or(b)thedistrictwithinwhichthecauseofactionorclaim,eitherwholly or in some material point arose;
or(c)the district within which by an
engagement or promise in writinggiven by the
defendant a debt or sum of money is made payable.˙Transfer of action4.If
an action is commenced in any registry, the Court or a Judge
orregistrar may order its removal to any other
registry, district or central, onsuch terms as to
costs as the Court or Judge may think fit.˙Power
to reserve judgments5.(1)Where any Judge
shall reserve a decision in any cause or matter theJudge
may draw up such decision in writing, and having signed the
same,forward it to the registrar of the
Court.(2)Upon the receipt of such decision, the
registrar shall notify the partiesortheirsolicitorsoftheregistrar’sintentionatsomeconvenienttimespecified by the registrar to read the same
in the courthouse at which suchCourt is held, or
other convenient place, and the registrar shall read the
sameaccordingly if either or both parties his,
her or their solicitor or solicitorsshall be present;
but if the parties or either of them shall not be present atsuch
reading, the registrar shall forward a copy of such judgment to
theabsent party or parties, and such decision
shall be of the same force andeffect as if
given by such Judge at the trial or hearing of such cause ormatter.˙Procedure in district registry6.Where a cause or matter is proceeding
in a district registry—(a)allproceedings,exceptwherebytheserulesitisotherwiseprovided or except where the Court or a
Judge or registrar shall
507Rules of the Supreme Courtotherwise order, shall be taken in the
district registry up to andincluding the
entry of final judgment, and every final judgmentand
every order for an account by reason of the default of thedefendant or by consent shall be entered in
the district registry inthe proper book;(b)all
writs of execution for enforcing any judgment or order
thereinshall issue from the district
registry;(c)all proceedings relating to the
following matters, namely—(i)leave to enter
judgment under order 17, rule 6;(ii)leave to issue or renew writs of
execution;(iii)examination of
judgment debtors for garnishee purposes orunder order 47,
rule 33;(iv)garnishee
orders;(v)charging orders;(vi)interpleader orders;shall,unlesstheCourtoraJudgeorregistrarshallinanyparticular
matter otherwise order, be taken in the district registry.†Costs˙Taxation of costs10.(1)All
costs and charges as between party and party shall be taxed
bythe registrar of the district in which the
costs were incurred.(2)For the purpose of this rule the
registrar may exercise all the powersof the taxing
officer.(3)However, in any cause or matter the
registrar may and shall at therequest of either
party refer the costs for taxation to a taxing officer at acentral registry.
508Rules of the Supreme Court†ORDER 96—REMOVAL OF ACTIONS TO
ANDFROM MAGISTRATES COURTS˙Removal of action from Magistrates
Court1.(1)If the Supreme
Court or a Judge thereof thinks it desirable that anyaction or proceeding commenced in a
Magistrates Court should be tried inthe Supreme Court
the Court or Judge may direct that the same shall betransferred to and heard and determined in
the Supreme Court upon suchterms as to
payment of costs, giving security for costs or otherwise, as
suchCourt or Judge thinks fit.(2)An action or proceeding shall not be
so removed when the amountclaimed does not exceed £50 ($100),
unless the defendant gives security tothe satisfaction
of such Court or Judge for the amount claimed, and also fora sum
not exceeding £100 ($200) for the costs in the Supreme
Court.˙Removal of action to Magistrates
Court2.(1)WhenanycauseorproceedingiscommencedintheSupremeCourt which a
Magistrates Court has jurisdiction to try, the defendant mayat
any time apply to the Court or a Judge for an order transferring
the actionor proceeding to a Magistrates Court, or the
Court or a Judge may on its,his or her own
motion call upon the plaintiff to show cause why such actionshould not be so transferred, and unless in
either case it is shown by theplaintiff—(a)thatunnecessarydelaywouldbecausedbyatrialintheMagistrates Court; or(b)that either by reason of the probable
cost of trial in the MagistratesCourt or by
reason of the questions of law involved in the action,thereisreasontobelievethatafairtrialcannotbehadintheMagistratesCourt,thecaseoughttobetriedintheSupremeCourt;the Court or
Judge may make an order directing that the cause or matter
betransferred to and heard and determined in
the Magistrates Court.(2)Thereupon the
registrar of the Supreme Court shall transmit to theregistrar of the Magistrates Court to which
the action is remitted, a copy of
509Rules of the Supreme Courtthe
order, together with a copy of the writ and of the pleadings (if
any).(3)The costs of the parties in respect of
the proceedings subsequent totheorderanduptojudgmentshallbeallowedaccordingtothescaleprescribed for Magistrates Courts.(4)The costs of any other proceeding
shall be at the discretion of theSupreme Court or
the Judge thereof.†ORDER 97—ARBITRATION˙Power to refer to arbitration1.(1)The Court or a
Judge may order any action, cause, or matter, or anyquestion arising therein, with or without
other matters within the jurisdictionof the Court in
dispute between the parties, to be referred to arbitration
ofsuch person or persons and in such manner and
on such terms as the Courtor Judge thinks reasonable.(2)The arbitrator or arbitrators or
umpires shall hear and determine thecase,andtheawardgivenbyhim,herorthemmaybeenteredasthejudgment in the cause or matter, or
shall be dealt with as a step thereinaccording as the
Court or Judge may order.(3)But the Court or
Judge may, on application, at the first sittings of theCourt
held after the expiration of 1 week after the entry of the award,
if ithas been entered as the judgment in the
action, set aside the award, or referthe award back to
the arbitrator, arbitrators, or umpire, or, with the consentof
the parties, revoke the reference or order another reference to be
made inthe manner before prescribed.
510Rules of the Supreme Court†ORDER 98—CROSS VESTING˙Interpretation1.In
this order—“cross-vesting laws”means theJurisdiction of Courts (Cross-vesting)
Act1987(Cwlth) and
theJurisdiction of Courts (Cross-vesting) Act
1987(Qld).“proceeding”includes an
action cause or matter.˙Applications2.Thisorderappliestoproceedingstowhichthecross-vestinglawsapply.˙Commencement of proceedings3.(1)Subject to
subrule (2) a proceeding in which a party relies on thecross-vestinglawsshallbecommencedinaccordancewiththerulesofcourt.(2)In a
case of doubt or difficulty as to the manner of commencement
ofa proceeding the Court may give
directions.(3)An application under subrule (2) shall
be by summons and may beex parte.(4)Apartywhoreliesonthecross-vestinglawsshallendorsetheprocess by which those laws are invoked
with a statement identifying eachclaim or ground
of defence, as the case may be, in respect of which thecross-vesting laws are invoked.(5)A failure to comply with subrule (4)
does not invalidate the process.(6)Whereapartyhasnotcompliedwithsubrule(4)andwishestoinvokethecross-vestinglawsthatpartyshallapplytotheCourtfordirections and the Court may give any
direction that it could give underrule
6.
511Rules of the Supreme Court˙Special federal matters4.(1)Where a matter
for determination is a special federal matter theplaintiff or the defendant, as the case may
be, shall give particulars of thatspecial matter in
the endorsement required under rule 3(4).(2)TheCourtshallnotdetermineaproceedingwhichraisesfordetermination a special federal matter unless
it is satisfied that the noticerequired by
section 6(3)(a) of the cross-vesting laws sufficiently
specifiesthe nature of that special federal
matter.˙Service5.(1)Notwithstanding order 11 any originating
proceeding or notice ofan originating proceeding that contains
a claim in which the cross-vestinglaws are relied
on may be served outside the jurisdiction.(2)Where a defendant is served outside the
jurisdiction under subrule (1)and the defendant
does not enter an unconditional appearance no further stepshall
be taken by the plaintiff unless the Court gives leave to
proceed.(3)The Court shall not give leave to
proceed unless it is satisfied—(a)that
jurisdiction under the cross-vesting laws is being invoked;and,(b)that
the Court is a convenient court in which to determine thematter.(4)An
application for leave to proceed shall be made by summons or
itmay be included in the summons for directions
under rule 6.(5)An order under subrule (2) giving
leave to proceed does not preventthe Court from
subsequently transferring the proceeding to another court.˙Directions6.(1)Thefirstpartytoinvokethecross-vestinglawsshalltakeoutasummons for
directions and serve it on all other parties.(2)Where the plaintiff is required to take out
the summons for directionsthe summons shall be taken out and
served within 7 days of the plaintiffbeing served with
the first notice of appearance.
512Rules of the Supreme Court(3)Where a defendant is required to take
out the summons for directionsthe summons shall
be taken out and served within 7 days of the delivery orservice, as the case may be, of the process
which invokes the cross-vestinglaws.(4)When a proceeding is transferred to
the Court from another court theparty who
originated the proceeding shall within 14 days of the date of
theorder transferring the proceeding file and
serve a summons for directionsand in default of
any other party may do so or the Court may call the partiesbefore it of its own motion.(5)On the hearing of the summons for
directions the Court shall giveany direction or
make any decision as to the conduct of the proceeding thatthe
Court thinks proper.(6)The Court may at the trial or hearing
of the proceeding vary an orderor decision made
on the summons for directions.˙Transfer of proceedings7.(1)Unless the Court orders otherwise when the
Court makes an ordertransferringaproceedingtoanothercourttheregistrarshallsendtotheCourt to which the proceeding is
transferred all documents filed and ordersmade in the
proceeding.(2)When a proceeding is transferred to
the Court from another court theregistrar shall
give it a number or title.˙Transfer on
Attorney-General’s application8.An
application by an Attorney-General under sections 5 or 6 of
thecross-vestinglawsforthetransferofaproceedingmaybemadebysummonswithouttheAttorney-Generalbecomingapartytotheproceeding.˙Transfer to Court when no proceeding
pending9.(1)Where a
proceeding is removed to the Court pursuant to section 8of
the cross-vesting laws the Court may immediately on that removal,
giveany direction, make any decision or direct
the parties to take any step thatthe Court sees
fit.
513Rules of the Supreme Court(2)The powers exercisable under subrule
(1)—(a)are in addition to the powers
exercisable under rule 6; and,(b)include the powers to give any directions
that could have beengivenbythecourtortribunalfromwhichtheproceedingwasremoved.†ORDER
99—ALTERNATIVE DISPUTE RESOLUTIONPROCESSES†Division 1—Definitions˙Definitions for order1.In this order—“ADR costs”include—(a)for
a mediation—the extra costs mentioned in rule 15;3and(b)for
a case appraisal—the extra costs mentioned in rule 24.4“referred dispute”meansadisputereferredtoacaseappraiserunderrule
21.“Supreme Court”includes a
Judge.†Division 2—Establishment of ADR
processes˙Approval as mediator2.(1)A person seeking
approval as a mediator must—(a)make
application in form 514; and3Rule
15 (Mediator may seek independent advice)4Rule
24 (Case appraiser may seek information)
514Rules of the Supreme Court(b)pay the fee prescribed under schedule
3, part 2; and(c)satisfytheSeniorJudgeAdministratorthepersonisasuitableperson to be
approved as a mediator.(2)TheSeniorJudgeAdministratormustinformtheregistrarofanapproval of a person as a
mediator.(3)If the Senior Judge Administrator
decides not to approve a person asmediator, the
Senior Judge Administrator must give the person a statementof
reasons for the decision.˙Approval as case
appraiser3.(1)A person seeking
approval as a case appraiser must—(a)be a
barrister or solicitor of 5 years standing; and(b)make
application in form 515; and(c)pay
the fee prescribed under schedule 3, part 2; and(d)satisfytheSeniorJudgeAdministratorthepersonisasuitableperson to be
approved as a case appraiser.(2)TheSeniorJudgeAdministratormustinformtheregistrarofanapproval of a person as a case
appraiser.(3)If the Senior Judge Administrator
decides not to approve a person ascaseappraiser,theSeniorJudgeAdministratormustgivethepersonastatement of reasons for the decision.˙ADR register4.The
ADR register must contain the fees notified to the registrar
underrule 5.˙Information to be given to registrar by ADR
convenors and venueproviders5.(1)A
person intending to provide a venue for ADR processes mustgive
notice to the registrar in form 516 of the person’s name and
addressand the address of the venue.
515Rules of the Supreme Court(2)Apersonintendingtoactasamediator,caseappraiserorvenueprovider for ADR
processes must give notice to the registrar of the fee theperson intends to charge for providing the
services or venue.(3)Ifapersonintendstochangethefeenotifiedtotheregistrar,theperson must give notice of the change to the
registrar in form 517 at least4 weeks before
the change is effective.(4)Notice of the
fee may be given by notifying the way the fee may beworked out, including, for example, an hourly
or daily rate of charge oranother way approved by the
registrar.˙Form of consent order for ADR
process6.For theSupreme Court of
Queensland Act 1991, section 100H,5theconsent order must be made, as far as
practicable, in form 518.˙Registrar to give
notice of proposed reference to ADR process7.(1)The
Supreme Court may direct the registrar to give written notice
tothe parties (the“referralnotice”) that the
parties’ dispute is to be referred,by order, to an
ADR process to be conducted by a specified mediator orcase
appraiser.(2)A party may object to the reference by
filing an objection notice in theregistry.(3)The objection notice must—(a)state the reasons why the party
objects to the referral; and(b)be
filed within 7 days after the objecting party receives the
referralnotice.(4)If
an objection notice is filed, the Supreme Court may require
theparties or their representatives to attend
before it (the“hearing”).(5)The court may make an order at the
hearing it considers appropriatein the
circumstances.5Section 100H (Parties may agree to ADR
process)
516Rules of the Supreme Court˙Proceedings referred to ADR process are
stayed8.If a dispute is referred to an ADR
process, the dispute and all claimsmade in the
dispute are stayed until—(a)the report of
the ADR convenor certifying the finish of the ADRprocess is filed with the registrar;
or(b)the Supreme Court otherwise
orders.˙When does a party impede an ADR
process?9.A party impedes an ADR process if the
party—(a)fails to attend at the process;
or(b)fails to participate in the process;
or(c)failstopayanamountthepartyisrequiredtopayunderareferring order within the time stated in
the order.†Division 3—Mediation˙Referral of dispute to appointed
mediator10.(1)A referring
order for a mediation must—(a)appoint as mediator—(i)a
specified mediator; or(ii)a mediator to be
selected by the parties; or(iii)if
all parties agree, a person who is not a mediator; and(b)include enough information about
pleadings, statements of issuesor other
documents to inform the mediator of the dispute and thepresent stage of the proceeding between the
parties; and(c)fix a period beyond which the
mediation may extend only withthe
authorisation of the parties or estimate how long the
mediationshould take to finish.(2)The
order must also—(a)fix the ADR costs or estimate the
costs to the extent possible; and
517Rules of the Supreme Court(b)state the percentage of ADR costs each
party must pay; and(c)state a time (not more than 7 days)
within which the ADR costs,including any
fee negotiated under subrule (3), must be paid tothe
registrar.(3)Instead of fixing or estimating the
appointed mediator’s fee, the ordermay direct the
parties to negotiate a fee with the appointed mediator.(4)A person appointed as mediator under
subrule (1)(a)(iii) is taken tobe a mediator for
the mediation and issues incidental to the mediation.(5)An order must, as far as practicable,
be made in form 519.˙When mediation
must start and finish11.Amediatormuststartamediationassoonaspossibleafterthemediator’s appointment and try to
finish the mediation within 28 days afterthe
appointment.˙Parties must assist mediator12.The parties must act reasonably and
genuinely in the mediation andhelp the mediator
to start and finish the mediation within the time estimatedor
fixed in the referring order.˙Mediator’s role13.(1)The
mediator may gather information about the nature and facts
ofthe dispute in any way the mediator
decides.(2)The mediator may decide whether a
party may be represented at themediation and, if
so, by whom.(3)Duringthemediation,themediatormayseetheparties,withorwithout their representatives, together or
separately.˙Liberty to apply14.Themediator,apartyortheregistrarmayapplytotheSupremeCourt at any time
for directions on any issue about the mediation.
518Rules of the Supreme Court˙Mediator may seek independent
advice15.(1)The mediator may
seek legal or other advice about the disputefrom independent
third parties.(2)However, if the advice involves extra
cost, the mediator must firstobtain—(a)the parties’ agreement to pay the
extra cost; or(b)the Supreme Court’s leave.(3)If the court gives leave under subrule
(2)(b), the court must also—(a)order the parties to pay the extra cost;
and(b)statethetimewithinwhichthepaymentmustbemadetotheregistrar.(4)The
mediator must disclose the substance of the advice to the
parties.˙Record of mediation resolution16.(1)Unless the
parties otherwise agree, the mediator must ensure thatan
agreement mentioned in theSupremeCourtofQueenslandAct1991,section 100N6is—(a)placed in a
sealed container, for example, an envelope; and(b)marked with the court file number;
and(c)endorsed‘NottobeopenedwithoutanorderoftheSupremeCourt or a
Judge’; and(d)filed in the court.(2)The container may be opened only if
the Supreme Court orders it tobe opened.(3)No fee is payable for filing the
container.˙Abandonment of mediation17.(1)Themediatormayabandonthemediationifthemediator6Section 100N (Mediated resolution
agreement)
519Rules of the Supreme Courtconsiders further efforts at mediation will
not lead to the resolution of thedispute or an
issue in the dispute.(2)Before
abandoning the mediation, the mediator must—(a)inform the parties of the mediator’s
intention; and(b)give them an opportunity to reconsider
their positions.˙Mediator to file certificate18.(1)For theSupreme Court of Queensland Act 1991,
section 100O,7the mediator must file a certificate in
form 520.(2)The certificate must not contain
comment about the extent to which aparty
participated or refused to participate in the mediation.(3)However, the certificate may indicate
that a party did not attend themediation.(4)No fee is payable for filing the
container.˙Unsuccessful mediations19.Ifamediationisunsuccessful,thedisputemaygototrialintheordinary way
without any inference being drawn against any party becauseof
the failure to settle at the mediation.˙Replacement of mediator20.(1)TheSupremeCourtmay,byfurtherorder,revoketheappointmentofamediatorandappointsomeoneelseasmediatorifthecourt is satisfied it is desirable to
do so.(2)Whenappointingasubstitutemediator,thecourtmaydecidetheamount (if any) to be paid to the retiring
mediator for work done.7Section 100O
(Mediator to file certificate)
520Rules of the Supreme Court†Division 4—Case appraisal˙Referral of dispute to appointed case
appraiser21.(1)A referring
order for a case appraisal must—(a)appoint as case appraiser—(i)a specified case appraiser; or(ii)a case appraiser
to be selected by the parties; and(b)include enough information about pleadings,
statements of issuesor other documents to inform the case
appraiser of the disputeand the present stage of the
proceeding between the parties; and(c)fix
a period beyond which the case appraisal may extend onlywith
the authorisation of the parties or estimate how long the
caseappraisal should take to finish.(2)The order must also—(a)fix the ADR costs or estimate the
costs to the extent possible; and(b)state the percentage of ADR costs each party
must pay; and(c)state a time (not more than 7 days)
within which the ADR costs,including any
fee negotiated under subrule (3), must be paid tothe
registrar.(3)Instead of fixing or estimating the
appointed case appraiser’s fee, theordermaydirectthepartiestonegotiateafeewiththeappointedcaseappraiser.(4)An
order must, as far as practicable, be made in form 519.˙Jurisdiction of case appraiser22.(1)ThecaseappraiserforareferreddisputehasthepoweroftheSupreme Court to decide the issues in
dispute in the referred dispute.(2)However, the case appraiser—(a)may only give a decision that could
have been given in the disputeif it had been
decided by the court; and
521Rules of the Supreme Court(b)cannot punish for contempt.(3)Subrule (1) is subject to rule
30.8˙Appearances23.Apartyappearingbeforeacaseappraiserhasthesamerightstoappear by lawyer or otherwise the party would
have if the appearance werebefore the
Supreme Court.˙Case appraiser may seek
information24.A case appraiser may ask anyone for
information and may obtain,and act on,
information obtained from anyone on any aspect of the
dispute.˙Case appraisal proceeding may be
recorded25.(1)A case appraiser
may have the case appraisal proceeding recordedif the case
appraiser considers it appropriate, in the special circumstances
ofthe case.(2)If
the proceeding is to be recorded, the case appraiser must decide
theextent to which, and the way in which, the
recording may be done.˙Case appraiser’s
decision26.(1)Acaseappraiser’sdecisionmustbeinwriting,butthecaseappraiser need
not give reasons for the decision.(2)However,acaseappraisermay,atanystageofacaseappraisalproceeding, decline to proceed further with
the proceeding.Example of subsection (2)—The
dispute proves to be unsuitable for case appraisal.(3)A copy of the decision must be given
to each party.8Rule30providesthatapartydissatisfiedwithacaseappraiser’sdecisionmayelect to go to trial.
522Rules of the Supreme Court˙Case appraiser’s decision on costs in
the dispute27.(1)Inareferreddispute,acaseappraiserhasthesamepowertoawardcostsinthedisputetheSupremeCourtwouldhavehadifithadheard and decided the dispute.(2)A case appraiser’s decision under rule
26(1) must include a decisionon costs in the
dispute.˙Case appraiser’s decision final unless
election made28.A case appraiser’s decision is final,
unless an election to go to trial ismade under rule
30.˙Case appraiser to file certificate and
decision29.(1)For theSupreme Court of Queensland Act 1991,
section 100P,9the case appraiser must file a
certificate in form 521.(2)If the case
appraiser makes a decision about the dispute or any issuein
the dispute, the case appraiser must—(a)place the written decision in a sealed
container, for example, anenvelope; and(b)mark
the container with the court file number; and(c)endorse the container ‘Not to be opened
without an order of theSupreme Court or a Judge’; and(d)file the container in the
court.(3)The container may be opened only if
the Supreme Court orders it tobe opened.(4)No fee is payable for filing the
certificate and decision.˙Dissatisfied party
may elect to go to trial30.(1)A party who is
dissatisfied with a case appraiser’s decision mayelect
to have the dispute go to trial in the ordinary way by filing an
election9Section 100P (Case appraiser to file
certificate and decision)
523Rules of the Supreme Courtin
form 522 with the registrar.(2)The
election must be filed within 28 days after the case
appraiser’scertificate is filed in registry.(3)If an election is filed—(a)the case appraiser’s decision ceases
to have effect other than asprovided by rule
31; and(b)the dispute must be decided in the
Supreme Court as if it hadnever been referred to the case
appraiser.˙Court to have regard to case
appraiser’s decision when awardingcosts31.(1)In this
rule—“challenger”means a party
who filed an election under rule 30.(2)If
the Supreme Court’s decision in the dispute is not more
favourableoverall to a challenger than the case
appraiser’s decision in the dispute wasto the
challenger, the costs of the action and the case appraisal must
beawarded against the challenger.(3)However, the court may make another
order about costs if the courtconsiders there
are special circumstances.(4)Ifallpartiesarechallengers,thecaseappraiser’sdecisionhasnoeffect on the
awarding of costs.˙Replacement of case appraiser32.(1)TheSupremeCourtmay,byfurtherorder,revoketheappointment of a case appraiser and appoint
someone else as case appraiserif the court is
satisfied it is desirable to do so.(2)When
appointing a substitute case appraiser, the court may decide
theamount (if any) to be paid to the retiring
case appraiser for work done.
524Rules of the Supreme Court†Division 5—ADR costs˙Payment of ADR costs33.EachpartytoanADRprocessisseverallyliablefortheparty’spercentage of the ADR costs in the first
instance.˙Party may pay another party’s ADR
costs34.(1)If a party to an
ADR process does not pay the party’s percentageof ADR costs,
another party may pay the amount.(2)Ifanotherpartypaystheamount,theamountistheotherparty’scosts
in any event.˙Registrar to facilitate payment of ADR
costs35.After the registrar has been paid all
payments under the referringorder and the ADR
process has finished, the registrar must pay the ADRconvenorandthevenueprovidertheirfeesfromthefundsheldforthepurpose.˙When ADR convenor or venue provider may
recover further costs36.(1)AnADRconvenororvenueprovidermayrecoveranamountmore than the
amount paid to the convenor or provider by the registrar—(a)if the referring order estimates the
ADR costs by fixing a fee rateand period for
which the rate is to be paid—only if the partiesauthorise the ADR process to continue beyond
the period fixed inthe referring order; or(b)inanyothercase—onlyifthepartiesagreeinwritingtothepaymentofagreateramountthantheamountpaidbytheregistrar.(2)Thepartiesareseverallyliableforanamountrecoverableundersubrule (1).(3)The
amount may be recovered as a debt payable to the convenor orprovider.
525Rules of the Supreme Court˙Court may extend period within which
costs are to be paid or grantrelief37.(1)A party may
apply to the Supreme Court for an order—(a)extending the time for payment to the
registrar of ADR costs; or(b)relieving the
party from the effects of noncompliance with anyrequirement about costs.(2)The
court may make any order it considers appropriate.˙Costs of failed ADR process are costs
in the dispute38.Unless otherwise ordered by the
Supreme Court, each party’s costsof and incidental
to an ADR process that did not result in the full settlementof
the dispute between the parties are the party’s costs in the
dispute.