Transport Operations (Road Use Management—Road Rules) Regulation 2009
Transport Operations (Road Use Management—Road Rules)
Regulation 2009
QueenslandTransport
Operations (Road Use Management) Act 1995TransportOperations(RoadUseManagement—RoadRules)Regulation2009Reprinted as in force on 30 November
2012Reprint No. 2CThis reprint is
prepared bythe Office of the Queensland Parliamentary
CounselWarning—This reprint is not an authorised
copy
Information about this reprintThisregulationisreprintedasat30November2012.Thereprintshowsthelawasamended by all amendments that
commenced on or before that day (Reprints Act 1992 s5(c)).The reprint
includes a reference to the law by which each amendment was
made—see listof legislation and list of annotations in
endnotes. Also see list of legislation for anyuncommenced
amendments.This page is specific to this reprint. See
previous reprints for information about earlierchanges made under
the Reprints Act 1992. A table of reprints is included in the
endnotes.Also see endnotes for information about when
provisions commenced.SpellingThe spelling of
certain words or phrases may be inconsistent in this reprint or
with otherreprints because of changes made in various
editions of the Macquarie Dictionary (forexample, in the
dictionary, ‘lodgement’ has replaced ‘lodgment’). Variations of
spellingwill be updated in the next authorised
reprint.Dates shown on reprintsReprints dated at
last amendmentAllreprintsproducedonorafter1July2002,authorised (that is, hard copy) and
unauthorised (that is, electronic), are dated as at the lastdate
of amendment. Previously reprints were dated as at the date of
publication. If anauthorised reprint is dated earlier than an
unauthorised version published before 1 July2002,itmeansthelegislationwasnotfurtheramendedandthereprintdateisthecommencement of the last amendment.If the
date of an authorised reprint is the same as the date shown for an
unauthorisedversion previously published, it merely means
that the unauthorised version was publishedbeforetheauthorisedversion.Also,anyrevisededitionofthepreviouslypublishedunauthorised
version will have the same date as that version.Replacement reprint dateIf the date of an
authorised reprint is the same as the dateshown on another
authorised reprint it means that one is the replacement of the
other.
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 1
Introductory[s 1]Transport
Operations (Road UseManagement—Road Rules) Regulation 2009[as
amended by all amendments that commenced on or before 30
November2012]Part 1IntroductoryDivision 1General1Short
titleThisregulationmaybecitedastheTransportOperations(Road Use
Management—Road Rules) Regulation 2009or asthe
Queensland Road Rules.2Commencement(1)This
regulation, other than sections 266 and 267(1), (1AA),(1AB), (1A), (1B) and (1C), commences on 12
October 2009.(2)Sections 266 and 267(1), (1AA), (1AB),
(1A), (1B) and (1C)commence on 11 March 2010.3ObjectTheobjectofthisregulationistoprovideroadrulesinQueenslandthataresubstantiallyuniformwithroadruleselsewhere in
Australia.Reprint 2C effective 30 November 2012Page
17
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 1 Introductory[s 4]Division 2Some features of
this regulation4DefinitionsThe dictionary
in schedule 5 defines particular words used inthis
regulation.5Compliance with Australian
StandardsIf this regulation requires a person to fit
or use a thing thatcomplieswithanAustralianStandard,thepersoncomplieswith
the requirement if, when the thing was manufactured, thething complied with a relevant Australian
Standard.6ExamplesA diagram under
a provision is an example for the provision.7–10Section numbers not usedNote—This regulation is based on the
Australian Road Rules. Some provisionsof the Australian
Road Rules contain provisions that are not relevant tothe
operation of this regulation. To maximise uniformity between
thisregulation and the Australian Road Rules,
the numbers of some sectionsthatarenotrelevanthavenotbeenusedinthenumberingofthisregulation, unless required for
provisions particular to the State.Page 18Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 2
Application of this regulation[s 11]Part
2Application of this regulationDivision 1Roads and
road-related areas11Regulation applies to vehicles and
road users on roadsand road-related areas(1)Thisregulationappliestovehiclesandroadusersonroadsand road-related
areas.(2)Areferenceinthisregulation(exceptinthisdivision)toaroadincludesareferencetoaroad-relatedarea,unlessotherwise
expressly stated in this regulation.Examples for
subsection (2)—1A reference in
section 146 (which deals with driving within a singlemarked lane or line of traffic) to the road
includes a reference to theroad-related area of the road.2A reference in section 200(1) (which
deals with certain heavy orlong vehicles stopping on roads) to a
length of road includes areference to the road-related area of
the length of road.3A reference in section 31 (which deals
with starting a right turnfrom a road, except a multi-lane road)
to a road does not include areferencetoaroad-relatedarea,becauseofthedefinitioninsubsection (5) of that section.12Section number not used13What is aroad-related
area(1)Aroad-related
areais any of the following—(a)an
area that divides a road;(b)a footpath or
nature strip adjacent to a road;(c)an
area that is not a road and that is open to the publicand
designated for use by cyclists or animals;(d)an
area that is not a road and that is open to, or used by,the
public for parking vehicles.Reprint 2C
effective 30 November 2012Page 19
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 2 Application of this
regulation[s 14](2)However, unless the contrary intention
appears, a reference inthisregulation(exceptthisdivision)toaroad-relatedareaincludes a reference to—(a)any
shoulder of a road; and(b)any other area
that is a footpath or nature strip as definedin the
dictionary.(3)In this section—shoulder, of
a road—(a)includes any part of the road that is
not designed to beused by motor vehicles in travelling along
the road; and(b)includes—(i)for
a kerbed road—any part of the kerb; and(ii)for
a sealed road—any unsealed part of the road,and any sealed
part of the road outside an edge lineon the road;
but(c)does not include a bicycle path,
footpath or shared path.Division 2Road users and
vehicles14Road usersAroad
useris a driver, rider, passenger or
pedestrian.15What is avehicleAvehicleincludes—(a)a motor vehicle, trailer and tram;
and(b)a bicycle; and(c)ananimal-drawnvehicle,andananimalthatisbeingridden or
drawing a vehicle; and(d)a combination;
andPage 20Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 2
Application of this regulation[s 16](e)a motorised wheelchair that can travel
at over 10km/h(on level ground);but does not
include another kind of wheelchair, a train, or awheeled recreational device or wheeled
toy.16Who is adriver(1)Adriveristhepersonwhoisdrivingavehicle(exceptamotorbike, bicycle, animal or
animal-drawn vehicle).(2)However,adriverdoesnotincludeapersonpushingamotorised wheelchair.17Who is arider(1)Arideristhepersonwhoisridingamotorbike,bicycle,animal or animal-drawn vehicle.(2)Ariderdoes
not include—(a)a passenger; or(b)a
person walking beside and pushing a bicycle.18Section number not used19Reference to driver includes rider
etc.Unlessotherwiseexpresslystatedinthisregulation,areference in this regulation (except in this
division)—(a)to adriver,
includes a reference to a rider; and(b)todriving, includes a
reference to riding.Reprint 2C effective 30 November
2012Page 21
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 3 Speed limits[s 20]Part
3Speed limits20Obeying the speed limitAdrivermustnotdriveataspeedoverthespeedlimitapplying to the driver for the length of
road where the driver isdriving.Maximum
penalty—40 penalty units.Note—See
also the Criminal Code, section 328A (Dangerous operation of
avehicle) and sections 83 (Careless driving
of motor vehicles) and 84(Dangerous driving of vehicles (other
than motor vehicles) etc.) of theAct.21Speed limit where a speed limit sign
applies(1)The speed limit applying to a driver
for a length of road towhich a speed limit sign applies is
the number of kilometresper hour indicated by the number on
the sign.(2)Aspeedlimitsignonaroadappliestothelengthofroadbeginningatthesignandendingatthenearestofthefollowing—(a)a
speed limit sign on the road with a different number onthe
sign;(b)an end speed limit sign or speed
derestriction sign on theroad;(c)if
the road ends at a T-intersection or dead end—the endof
the road.Page 22Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 3 Speed
limits[s 22]Examples—Speed limit sign (Standard sign)Other
signsSpeed limit sign (Variable
illuminatedmessage sign)End speed limit
signSpeed derestriction sign22Speed
limit in a speed limited area(1)The
speed limit applying to a driver for any length of road in aspeedlimitedareaisthenumberofkilometresperhourindicated by the
number on the area speed limit sign on a roadinto the area,
unless another speed limit applies to the driverfor
the length of road under another section of this part.Example of another speed limit—Although an area speed limit sign on a road
into a speed limited areamay indicate a speed limit of 60km/h,
a particular length of road in thearea may have a
school zone sign indicating a 40km/h speed limit forthat
length of road.(2)Aspeed limited
areais the network of roads in an area
with—(a)anareaspeedlimitsignoneachroadintothearea,indicating the
same number; andReprint 2C effective 30 November 2012Page
23
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 3 Speed limits[s 23](b)an end area speed limit sign on each
road out of the area.(3)In this
section—road,insubsection(2)(a)and(b),doesnotincludearoad-related area.Examples—Area speed limit signEnd
area speed limit sign23Speed limit in a
school zone(1)The speed limit applying to a driver
for any length of road in aschool zone is
the number of kilometres per hour indicated bythe number on
the school zone sign on a road, or the road, intothe
zone.(2)Aschool
zoneis—(a)ifthereisaschoolzonesignandanendschoolzonesign, or a speed
limit sign with a different number on thesign, on a
road—that length of road; or(b)if
there is a school zone sign on a road that ends in adead
end and there is no sign mentioned in paragraph(a),onthelengthofroadbeginningatthesignandending at the dead end—that length of
road.Page 24Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 3 Speed
limits[s 24]Examples—School zone signEnd school zone
sign24Speed limit in a shared zone(1)The speed limit applying to a driver
for any length of road in ashared zone is
the number of kilometres per hour indicated bythe number on
the shared zone sign on a road into the zone.(2)Ashared zoneis the network
of roads in an area with—(a)a shared zone
sign on each road into the area, indicatingthe same number;
and(b)an end shared zone sign on each road
out of the area.Examples—Shared
zone signReprint 2C effective 30 November 2012End
shared zone signPage 25
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 3 Speed limits[s 24A]24ASpeed limit for certain
vehicles(1)This section applies to a driver
despite a higher speed limitthat would
otherwise apply to the driver under this part.(2)The
speed limit applying to the following drivers for a lengthof
road where the driver is driving is—(a)foradriverdrivingatractortowingasugarcanetrailer—50km/h;(b)for
a driver driving an oversize vehicle that is required totravel with a pilot or escort
vehicle—80km/h;(c)for a driver driving a road
train—90km/h;(d)for a driver driving a bus with a GVM
over 5t, or anothervehicle with a GVM over 12t—100km/h.(3)In this section—sugar cane
trailerhas the meaning given in the Standards
andSafety Regulation.tractordoesnotincludeamotorvehiclebuilttotowasemitrailer.25Speed
limit elsewhere(1)If a speed limit sign does not apply
to a length of road and thelength of road
is not in a speed limited area, school zone orshared zone, the
speed limit applying to a driver for the lengthof road is the
default speed limit.(2)Thedefault speed limitapplying to a
driver for a length ofroad is—(a)for
a road in a built-up area—50km/h; or(b)for
a road that is not in a built-up area—100km/h.Page 26Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 26]Part 4Making turnsDivision 1Left
turns26Application of division to
roundabouts, road-relatedareas and adjacent land(1)This division does not apply to a
driver entering or leaving aroundabout.(2)This
division applies to a driver turning left from a road into aroad-related area or adjacent land, or from
a road-related areainto a road, as if the driver were turning
left at an intersection.(3)In this
section—roaddoes not include
a road-related area.27Starting a left turn from a road
(except a multi-lane road)(1)A driver turning
left at an intersection from a road (except amulti-laneroad)mustapproachandentertheintersectionfrom as near as
practicable to the far left side of the road.Maximum
penalty—20 penalty units.(1A)Subsection(1)alsoappliestoariderofabicyclewhoapproaches and enters an intersection
from a bicycle storagearea.(1B)Despite subsection (1), if there is space in
a bicycle storagearea for 2 riders of bicycles to be next to
each other, the rideron the right may approach and enter
the intersection as near aspracticable to
the right side of the other rider, but only if thatotherriderapproachesandenterstheintersectioninaccordance with this section.(2)In this section—roaddoes
not include a road-related area.Reprint 2C
effective 30 November 2012Page 27
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 28]Example—Starting a left turn from a road (except a
multi-lane road)28Starting a left turn from a multi-lane
road(1)A driver turning left at an
intersection from a multi-lane roadmust approach
and enter the intersection from within the leftlane
unless—(a)the driver is required or permitted to
approach and enterthe intersection from within another marked
lane undersection 88(1), 92 or 159; or(b)the driver is turning, at B lights or
a white traffic arrow,in accordance with part 17, division
2; or(c)subsection (1A) or (2) applies to the
driver.Maximum penalty—20 penalty units.Page
28Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 28]Example for
subsection (1)(a)—Starting a left turn on a multi-lane
road with traffic lane arrows as required orpermitted under
section 92(1A)A driver turning
left at an intersection from a multi-lane roadthat has a slip
lane must approach and enter the intersection—(a)from
within the slip lane; or(b)if there is an
obstruction that prevents the driver fromenteringtheintersectionfromwithinthesliplane—from within
the left lane.Maximum penalty—20 penalty units.(2)Adrivermayapproachandentertheintersectionfromthemarked lane next to the left lane as
well as, or instead of, theleft lane
if—(a)the driver’s vehicle, together with
any load or projection,is 7.5m long, or longer; and(b)thevehicledisplaysadonotovertaketurningvehiclesign; and(c)any
part of the vehicle is within 50m of the nearest pointof
the intersection; and(d)it is not
practicable for the driver to turn left from withinthe
left lane; andReprint 2C effective 30 November 2012Page
29
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 28](e)the driver can safely occupy the next
marked lane andcan safely turn left at the intersection by
occupying thenext marked lane, or both lanes.Example—Long
vehicle turning left from the left lane and next marked lane(2A)Ifthereisabicyclestorageareabeforeanintersectionthatextends across 1 or more marked lanes of a
multi-lane road, ariderofabicycleturningleftmustapproachandentertheintersection from within the part of the
bicycle storage areathat is directly in front of the left
marked lane or of a bicyclelane that is on
the left side of the road.Maximum penalty—20 penalty
units.(3)In this section—left lanemeans—(a)the
marked lane nearest to the far left side of the road; or(b)if there is an obstruction (for
example, a parked car orroadworks)inthatmarkedlane—themarkedlanenearest to that
marked lane that is not obstructed.marked
lane, for a driver, does not include a special
purposelane in which the driver is not permitted to
drive.Page 30Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 29]Examples of do
not overtake turning vehicle signs—29Making a left turn as indicated by a
turn line(1)If a driver is turning left at an
intersection and there is a turnline indicating
how the turn is required to be made, the drivermust make the
turn as indicated by the turn line unless—(a)thedriveristurning,atBlightsortrafficarrows,inaccordance with part 17, division 2;
or(b)subsection (2) applies to the
driver.Maximum penalty—20 penalty units.Example—Making a left
turn as indicated by a turn lineReprint 2C
effective 30 November 2012Page 31
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 30](2)Adrivermayturnleftatanintersectionotherthanasindicated by a turn line if—(a)the driver’s vehicle, together with
any load or projection,is 7.5m long, or longer; and(b)thevehicledisplaysadonotovertaketurningvehiclesign; and(c)it
is not practicable for the driver to turn left as indicatedby
the turn line; and(d)the driver can safely turn left other
than as indicated bythe turn line.Examples of do
not overtake turning vehicle signs—Division 2Right turns30Application of division to certain right
turns(1)This division does not apply
to—(a)a driver turning right at an
intersection where there is ahook turn only
sign; or(b)the rider of a bicycle making a hook
turn under division3; or(c)a
driver making a U-turn; or(d)a driver
entering or leaving a roundabout.Page 32Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 31](2)This
division applies to a driver turning right from a road intoaroad-relatedareaoradjacentland,orfromaroad-relatedareaintoaroad,asifthedriverwereturningrightatanintersection.(3)In
this section—roaddoes not include
a road-related area.31Starting a right turn from a road
(except a multi-lane road)(1)A driver turning
right at an intersection from a road (except amulti-lane road)
must approach and enter the intersection inaccordance with
this section.Maximum penalty—20 penalty units.(2)If the road has a dividing line or
median strip, the driver mustapproach and
enter the intersection from the left of, parallelto,
and as near as practicable to, the dividing line or medianstrip.(3)If
the road does not have a dividing line or median strip and
isnot a one-way road, the driver must approach
and enter theintersectionfromtheleftof,parallelto,andasnearaspracticable to, the centre of the
road.(4)If the road is a one-way road, the
driver must approach andentertheintersectionfromasnearaspracticabletothefarright side of
the road.(4A)Subsections (2),
(3) and (4) also apply to a rider of a bicyclewhoapproachesandentersanintersectionfromabicyclestorage
area.(4B)Despitesubsections(2),(3)and(4),ifthereisspaceinabicycle storage area for 2 riders of
bicycles to be next to eachother,theriderontheleftmayapproachandentertheintersection as near as practicable to the
left side of the otherrider,butonlyifthatotherriderapproachesandenterstheintersection in accordance with this
section.(5)In this section—roaddoes
not include a road-related area.Reprint 2C
effective 30 November 2012Page 33
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 32]Examples—Example 1Startingarightturnfromaroadwith
a dividing lineExample 2Starting a right
turn from a one-wayroad32Starting a right
turn from a multi-lane road(1)A
driver turning right at an intersection from a multi-lane
roadmust approach and enter the intersection
from within the rightlane unless—(a)the
driver is required or permitted to approach and entertheintersectionfromwithinanothermarkedlaneinaccordance with section 89(1), 92 or
159; or(b)the driver is turning, at B lights or
a white traffic arrow,in accordance with part 17, division
2; or(c)subsection (2) applies to the
driver.Maximum penalty—20 penalty units.Page
34Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 32]Example for
subsection (1)(a)—Starting a right turn on a multi-lane road
with traffic lane arrows as required orpermitted under
section 92(2)Adrivermayapproachandentertheintersectionfromthemarked lane next to the right lane as
well as, or instead of, theright lane
if—(a)the driver’s vehicle, together with
any load or projection,is 7.5m long, or longer; and(b)thevehicledisplaysadonotovertaketurningvehiclesign; and(c)any
part of the vehicle is within 50m of the nearest pointof
the intersection; and(d)itisnotpracticableforthedrivertoturnrightfromwithin the right
lane; and(e)the driver can safely occupy the next
marked lane andcan safely turn right at the intersection by
occupying thenext marked lane, or both lanes.(2A)Ifthereisabicyclestorageareabeforeanintersectionthatextends across 1 or more marked lanes of a
multi-lane road, arider of a bicycle turning right (but not
making a hook turn)must approach and enter the intersection
from within the partof the bicycle storage area that is
directly in front of the rightReprint 2C
effective 30 November 2012Page 35
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 33]marked lane or of a bicycle lane that is on
the right side of theroad.Maximum
penalty—20 penalty units.(3)In this
section—marked lane, for a driver,
does not include a special purposelane in which
the driver is not permitted to drive.right
lanemeans—(a)the
marked lane nearest to the dividing line or medianstrip on the road; or(b)if
there is an obstruction (for example, a parked car orroadworks)inthatmarkedlane—themarkedlanenearest to that
marked lane that is not obstructed.Examples of do
not overtake turning vehicle signs—33Making a right turn(1)A driver turning right at an
intersection must make the turn inaccordance with
this section unless—(a)thedriveristurning,atBlightsortrafficarrows,inaccordance with part 17, division 2;
or(b)subsection (4) applies to the
driver.Maximum penalty—20 penalty units.(2)If there is a turn line indicating how
the turn is required to bemade, the driver must make the turn as
indicated by the turnline.Page 36Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 33](3)If
there is no turn line indicating how the turn is required to
bemade, the driver must make the turn so the
driver—(a)passes as near as practicable to the
right of the centre ofthe intersection; and(b)turns into the left of the centre of
the road the driver isentering, unless the driver is
entering a one-way road.Examples—Making a right turn as indicated byturn
linesMaking a right turn from a roadwith
no turn lines indicating how tomake the turn
(diagram shows thelocation of the centre of theintersection)(4)A
driver may turn right other than as indicated by a turn lineif—(a)the driver’s
vehicle, together with any load or projection,is 7.5m long, or
longer; and(b)thevehicledisplaysadonotovertaketurningvehiclesign; and(c)itisnotpracticableforthedrivertoturnrightasindicated by the turn line; and(d)thedrivercansafelymaketheturnotherthanasindicated by the turn line.Reprint 2C effective 30 November 2012Page
37
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 34]Examples of do not overtake turning vehicle
signs—Division 3Hook turns at
intersections34Making a hook turn at a hook turn only
sign(1)A driver turning right at an
intersection with traffic lights anda hook turn only
sign must turn right by making a hook turn inaccordance with
this section.Maximum penalty—20 penalty units.(2)To make ahook turn,
the driver must take, in sequence, eachof the following
steps—1Approachandentertheintersectionfromasnearaspracticable to the far left side of the road
that the driveris leaving.2Move
forward—(a)keeping as near as practicable to the
far left side ofthe intersection; and(b)keeping clear of any marked foot
crossing;until the driver is as near as practicable
to the far side ofthe road that the driver is entering.3Remainatthepositionreachedunderstep2untilthetrafficlightsontheroadthatthedriverisenteringchange to
green.4Turn right into the road that the
driver is entering.Page 38Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 35](3)In
this section—roaddoes not include
a road-related area.Examples—Hook
turn only signMaking a hook turn at a hook turnonly
sign35Optional hook turn by a bicycle
rider(1)The rider of a bicycle turning right
at an intersection, withouta hook turn only
sign or a no hook turn by bicycles sign, mayturn right at
the intersection by making—(a)a
right turn under division 2; or(b)a
hook turn under this section.(2)Theridermustmakeahookturnunderthissectioninaccordance with subsection (3).Maximum penalty—20 penalty units.(3)To make ahook turnunder this section, the rider must take,
insequence, each of the following
steps—Reprint 2C effective 30 November 2012Page
39
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 35]1Approachandentertheintersectionfromasnearaspracticable to the far left side of the road
that the rider isleaving.2Move
forward—(a)keeping as near as practicable to the
far left side ofthe intersection; and(b)keeping clear of any marked foot crossing;
and(c)keeping clear, as far as practicable,
of any driverturning left from the left of the
intersection;until the rider is as near as practicable to
the far side ofthe road that the rider is entering.3If there are traffic lights at the
intersection, remain at theposition reached
under step 2 until the traffic lights onthe road that
the rider is entering change to green.4If
there are no traffic lights at the intersection, remain atthepositionreachedunderstep2untiltheriderhasgiven way to approaching drivers on the road
that therider is leaving.5Turn
right into the road that the rider is entering.(4)To
make ahook turnunder this
section at an intersection thathasabicyclehookturnstorageareaontheleftsideoftheintersection as
the rider approaches the intersection, the ridermust
take the following initial 2 steps instead of the initial 2steps listed in subsection (3)—1Approach the intersection from the far
left side of theroadtheriderisleavingandentertheintersectionbymoving into the bicycle hook turn storage
area, keepingclear of any marked foot crossing.2Move forward in the bicycle hook turn
storage area untilthe rider is as near as practicable to the
far side of theroad that the rider is entering.Page
40Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 35]Example
1—Bicycle rider making a hook turn at an
intersection without traffic lights where thereis a bicycle hook
turn storage areaExample 2—Bicycle rider
making a hook turn at an intersection without traffic lights(5)In this section—bicycle hook
turn storage area—(a)meansanareabetweenanintersectionandamarkedfoot crossing,
or if there is no marked foot crossing, aReprint 2C
effective 30 November 2012Page 41
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 36]stop
line, before the intersection that has painted on it 1or
more bicycle symbols and 1 or more right traffic lanearrows; and(b)includesanylinethatdelineatestherightsideofthearea, and any
line that delineates the left side of the areathatisnotalsoastoplineorpartofamarkedfootcrossing and excludes any bicycle storage
area.36Bicycle rider making a hook turn
contrary to no hook turnby bicycles signTheriderofabicyclemustnotmakeahookturnatanintersection
that has a no hook turn by bicycles sign.Maximum
penalty—20 penalty units.Example—No hook turn by
bicycles signDivision 4U-turns37Beginning a U-turnA driver must
not begin a U-turn unless—(a)the driver has a
clear view of any approaching traffic;and(b)thedrivercansafelymaketheU-turnwithoutunreasonably obstructing the free movement
of traffic.Maximum penalty—20 penalty units.Page
42Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 4 Making
turns[s 38]38Giving way when making a U-turnA
driver making a U-turn must give way to all vehicles andpedestrians.Maximum
penalty—20 penalty units.39Making a U-turn
contrary to a no U-turn sign(1)A
driver must not make a U-turn at a break in a dividing striponaroadifthereisanoU-turnsignatthebreakinthedividing strip.Maximum
penalty—20 penalty units.(2)A driver must
not make a U-turn on a length of road to whicha no U-turn sign
applies.Maximum penalty—20 penalty units.(3)AnoU-turnsignonaroad(exceptanoU-turnsignatanintersectionoratabreakinadividingstrip)appliestothelength of road
beginning at the sign and ending at the nearerof the
following—(a)the next intersection on the
road;(b)if the road ends at a T-intersection
or dead end—the endof the road.Example of no
U-turn signs—No U-turn sign (Standard sign)No
U-turn sign (Variableilluminated message sign)Reprint 2C effective 30 November 2012Page
43
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 4 Making turns[s 40]40Making a U-turn at an intersection
with traffic lightsA driver must not make a U-turn at an
intersection with trafficlightsunlessthereisaU-turnpermittedsignattheintersection.Maximum
penalty—20 penalty units.Example of U-turn permitted
sign—41Making a U-turn at an intersection
without traffic lightsA driver must not make a U-turn at an
intersection withouttraffic lights if there is a no U-turn
sign at the intersection.Maximum penalty—20 penalty
units.42Starting a U-turn at an
intersectionAdrivermakingaU-turnatanintersectionmuststarttheU-turn—(a)if
the road where the driver is turning has a dividing lineormedianstrip—fromthemarkedlanenearest,orasnear as practicable, to the dividing
line or median strip;or(b)inanyothercase—fromtheleftofthecentreoftheroad.Maximum
penalty—20 penalty units.Page 44Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 5 Change of
direction and stop signals[s 43]Example—Starting a U-turn on a road with a median
strip43Section number not usedPart
5Change of direction and stopsignalsDivision 1Change of direction signals44Division does not apply to entering or
leaving aroundaboutThis division
does not apply to a driver entering, in or leavinga
roundabout.45What ischanging
direction(1)A driverchanges
directionif—Reprint 2C effective 30 November
2012Page 45
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 5 Change of direction and stop
signals[s 45](a)the
driver changes direction to the left; or(b)the
driver changes direction to the right.(2)Adriverchangesdirectiontotheleftbydoinganyofthefollowing—(a)turning left;(b)changing marked lanes to the left;(c)diverging to the left;(d)entering a marked lane, or a line of
traffic, to the left;(e)moving to the
left from a stationary position;(f)turning left into a marked lane, or a line
of traffic, from amedian strip parking area;(g)at a T-intersection where the
continuing road curves totheright—leavingthecontinuingroadtoproceedstraight ahead
onto the terminating road.(3)A driverchanges direction to the rightby
doing any of thefollowing—(a)turning right;(b)changing marked lanes to the right;(c)diverging to the right;(d)entering a marked lane, or a line of
traffic, to the right;(e)moving to the
right from a stationary position;(f)turning right into a marked lane, or a line
of traffic, froma median strip parking area;(g)making a U-turn;(h)at a
T-intersection where the continuing road curves tothe
left—leaving the continuing road to proceed straightahead onto the terminating road.Page
46Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 5 Change of
direction and stop signals[s 46]Examples for
subsections (2)(g) and (3)(h)—Example 1Example 2Driver indicating
change of direction at aDriver indicating change of direction
at aT-intersection where the continuing
roadT-intersection where the continuing
roadcurves to the right and the driver iscurves to the left and the driver isproceeding straight ahead onto theproceeding straight ahead onto theterminating roadterminating
road46Giving a left change of direction
signal(1)Before a driver changes direction to
the left, the driver mustgivealeftchangeofdirectionsignalinaccordancewithsection 47 for long enough to comply
with—(a)subsection (2); and(b)if subsection (3) applies to the
driver—subsection (3).Maximum penalty—20 penalty
units.(2)The driver must give the change of
direction signal for longenoughtogivesufficientwarningtootherdriversandpedestrians.(3)If
the driver is about to change direction by moving from astationary position at the side of the road
or in a median stripparkingarea,thedrivermustgivethechangeofdirectionReprint 2C
effective 30 November 2012Page 47
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 5 Change of direction and stop
signals[s 47]signalforatleast5secondsbeforethedriverchangesdirection.(4)The
driver must stop giving the change of direction signal assoon
as the driver completes the change of direction.Maximum penalty—20 penalty units.(5)This section does not apply to a
driver if the driver’s vehicle isnot fitted with
direction indicator lights.47How to give a
left change of direction signalThe driver of a
vehicle must give a left change of directionsignal by
operating the vehicle’s left direction indicator lights.48Giving a right change of direction
signal(1)Before a driver changes direction to
the right, the driver mustgivearightchangeofdirectionsignalinaccordancewithsection 49 for long enough to comply
with—(a)subsection (2); and(b)if subsection (3) applies to the
driver—subsection (3).Maximum penalty—20 penalty
units.(2)The driver must give the change of
direction signal for longenoughtogivesufficientwarningtootherdriversandpedestrians.(3)If
the driver is about to change direction by moving from astationary position at the side of the road
or in a median stripparkingarea,thedrivermustgivethechangeofdirectionsignalforatleast5secondsbeforethedriverchangesdirection.(3A)Subsection (3) does not apply to the rider
of a bicycle that isstopped in traffic but not
parked.(4)The driver must stop giving the change
of direction signal assoon as the driver completes the
change of direction.Maximum penalty—20 penalty
units.Page 48Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 5 Change of
direction and stop signals[s 49](5)This
section does not apply to—(a)thedriverofatramthatisnotfittedwithdirectionindicator lights; or(b)the
rider of a bicycle making a hook turn.49How
to give a right change of direction signal(1)The
driver of a vehicle must give a right change of directionsignalbyoperatingthevehicle’srightdirectionindicatorlights.(2)However, if the vehicle’s direction
indicator lights are not inworking order or
are not clearly visible, or the vehicle is notfitted with
direction indicator lights, the driver must give thechange of direction signal by—(a)giving a hand signal in accordance
with section 50; or(b)usingamechanicalsignallingdevicefittedtothevehicle.50How
to give a right change of direction signal by giving ahand
signalTo give a hand signal for changing direction
to the right, thedriver must extend the right arm and hand
horizontally and atright angles from the right side of the
vehicle, with the handopen and the palm facing the direction
of travel.Reprint 2C effective 30 November 2012Page
49
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 5 Change of direction and stop
signals[s 51]Example—Giving a hand signal for changing direction
to the right51When use of direction indicator lights
permittedThe driver of a vehicle must not operate a
direction indicatorlight except—(a)to
give a change of direction signal when the driver isrequired to give the signal under this
regulation; or(b)as part of the vehicle’s hazard
warning lights.Maximum penalty—20 penalty units.Division 2Stop
signals52Division does not apply to bicycle
riders or certain tramdriversThis division
does not apply to—(a)the rider of a bicycle; or(b)the driver of a tram that is not
fitted with brake lights.Page 50Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 5 Change of
direction and stop signals[s 53]53Giving a stop signal(1)A
driver must give a stop signal in accordance with section 54before stopping or when suddenly
slowing.Maximum penalty—20 penalty units.(2)If the driver is stopping, the driver
must give the stop signalfor long enough to give sufficient
warning to other road users.Maximum
penalty—20 penalty units.(3)If the driver is
slowing suddenly, the driver must give the stopsignal while
slowing.Maximum penalty—20 penalty units.54How to give a stop signal(1)The driver of a vehicle must give a
stop signal by means of thevehicle’s brake
lights.(2)However, if the vehicle’s brake lights
are not in working orderor are not clearly visible, or the
vehicle is not fitted with brakelights, the
driver must give the stop signal by—(a)giving a hand signal in accordance with
section 55; or(b)usingamechanicalsignallingdevicefittedtothevehicle.55How
to give a stop signal by giving a hand signal(1)To
give a hand signal for stopping or suddenly slowing, thedriver must extend the right arm and hand at
right angles fromthe right side of the vehicle with—(a)theupperarmhorizontalandtheforearmandhandpointing
upwards; and(b)thehandopenandthepalmfacingthedirectionoftravel.(2)However, the rider of a motorbike may give
the hand signalby extending the left arm and hand at right
angles from the leftside of the motorbike with—Reprint 2C effective 30 November 2012Page
51
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 6 Traffic lights, traffic arrows
and twin red lights[s 56](a)theupperarmhorizontalandtheforearmandhandpointing
upwards; and(b)thehandopenandthepalmfacingthedirectionoftravel.Example—Giving a hand signal for stopping or
suddenly slowingPart 6Traffic lights,
traffic arrows andtwin red lightsDivision 1Obeying traffic lights and trafficarrows56Stopping on a red traffic light or
arrow(1)A driver approaching or at traffic
lights showing a red trafficlight—(a)must stop—Page 52Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 6 Traffic
lights, traffic arrows and twin red lights[s 56](i)if there is a stop line at or near the
traffic lights—asnear as practicable to, but before reaching,
the stopline; or(ii)if
there is a stop here on red signal sign at or nearthetrafficlights,butnostopline—asnearaspracticable to, but before reaching,
the sign; or(iii)if there is no
stop line or stop here on red signalsignatornearthetrafficlights—asnearaspracticable to, but before reaching, the
nearest oronly traffic lights; and(b)must
not proceed until—(i)thetrafficlightschangetogreenorflashingyellow;
or(ii)a green or
flashing yellow traffic arrow is showing,if the driver is
turning in the direction indicated bythe
arrow.Maximum penalty—20 penalty units.Example for subsection (1)(a)(ii)—Stopping at a stop here on red signal sign
on a road the driver is enteringReprint 2C
effective 30 November 2012Page 53
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 6 Traffic lights, traffic arrows
and twin red lights[s 56](1A)However, if the traffic lights are at an
intersection with a leftturn on red after stopping sign and
the driver is turning left atthe
intersection, the driver may turn left after stopping.(2)A driver approaching or at traffic
arrows showing a red trafficarrow who is
turning in the direction indicated by the arrow—(a)must stop—(i)ifthereisastoplineatornearthetrafficarrows—asnearaspracticableto,butbeforereaching, the
stop line; or(ii)if there is a
stop here on red arrow sign at or nearthetrafficarrows,butnostopline—asnearaspracticable to, but before reaching,
the sign; or(iii)if there is no
stop line or stop here on red arrowsignatornearthetrafficarrows—asnearaspracticable to, but before reaching, the
nearest oronly traffic arrows; and(b)must
not proceed until—(i)thetrafficarrowschangetogreenorflashingyellow;
or(ii)the traffic
lights show a green or flashing yellowtrafficlightandthereisnoredoryellowtrafficarrow showing.Maximum
penalty—20 penalty units.Examples—Stop here on red
signal signPage 54Stop here on red
arrow signReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 6 Traffic
lights, traffic arrows and twin red lights[s 57](3)Ifthereisabicyclestorageareabeforeanytrafficlightsreferred to in subsection (1) or (2), a
reference to the stop linein subsection (1)(a) or (2)(a)—(a)in the case of a driver of a motor
vehicle, is a referenceto the first stop line that the driver
comes, or came, to inapproaching the lights; or(b)in the case of a rider of a bicycle,
is a reference to thestop line that is nearest to the
intersection.57Stopping for a yellow traffic light or
arrow(1)Adriverwhoisapproaching,orat,trafficlightsshowingayellow traffic light—(a)must
stop—(i)if there is a stop line at or near the
traffic lights andthe driver can stop safely before reaching
the stopline—asnearaspracticableto,andbeforereaching, the
stop line; or(ii)if there is no
stop line at or near the traffic lightsand the driver
can stop safely before reaching thetraffic
lights—as near as practicable to, and beforereaching, the
nearest traffic lights; or(iii)ifthetrafficlightsareatanintersectionandthedriver can not stop safely under
subparagraph (i) or(ii),butcanstopsafelybeforeenteringtheintersection—before entering the
intersection; and(b)must not proceed until the traffic
lights—(i)change to green or flashing yellow;
or(ii)show no traffic
light.Maximum penalty—20 penalty units.(2)A driver who is approaching, or at,
traffic arrows showing ayellow traffic arrow, and turning in
the direction indicated bythe arrow—(a)must
stop—Reprint 2C effective 30 November 2012Page
55
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 6 Traffic lights, traffic arrows
and twin red lights[s 58](i)if
there is a stop line at or near the traffic arrowsand
the driver can stop safely before reaching thestopline—asnearaspracticableto,andbeforereaching, the
stop line; or(ii)if there is no
stop line at or near the traffic arrowsand the driver
can stop safely before reaching thetrafficarrows—asnearaspracticableto,andbefore reaching, the nearest traffic
arrows; or(iii)if the traffic
arrows are at an intersection and thedriver can not
stop safely under subparagraph (i) or(ii),butcanstopsafelybeforeenteringtheintersection—before entering the
intersection; and(b)must not proceed until the traffic
arrows—(i)change to green or flashing yellow;
or(ii)show no traffic
arrow.Maximum penalty—20 penalty units.(3)Ifthetrafficlightsorarrowsareatanintersectionandthedrivercannotstopsafelyundersubsection(1)or(2)andenters the intersection, the driver must
leave the intersectionas soon as the driver can do so
safely.Maximum penalty—20 penalty units.(4)Ifthereisabicyclestorageareabeforeanytrafficlightsreferred to in subsection (1) or (2), a
reference to the stop linein subsection (1)(a) or (2)(a)—(a)in the case of a driver of a motor
vehicle, is a referenceto the first stop line that the driver
comes, or came, to inapproaching the lights; or(b)in the case of a rider of a bicycle,
is a reference to thestop line that is nearest to the
intersection.58Exceptions to stopping for a red or
yellow traffic light(1)AdriverapproachingorattrafficlightsshowingaredoryellowtrafficlightdoesnothavetostopifagreentrafficPage
56Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 6 Traffic
lights, traffic arrows and twin red lights[s 59]arrow is also showing and the driver is
turning in the directionindicated by the arrow.(2)Adriverturningatanintersectionwithtrafficlightswhoapproaches,orisat,aredtrafficlightontheroadthatthedriver is entering does not have to stop for
the red traffic lightif there is no stop line or stop here
on red signal sign at or nearthe traffic
light.59Proceeding through a red traffic
light(1)If traffic lights at an intersection
or marked foot crossing areshowingaredtrafficlight,adrivermustnotentertheintersection or marked foot crossing.Maximum penalty—20 penalty units.(2)However, if the traffic lights are at
an intersection with a leftturn on red
after stopping sign and the driver is turning left attheintersection,thedrivermayturnleftbeforethetrafficlights change to
green or flashing yellow.Example—Left turn on red
after stopping sign(3)Subsection(1)doesnotapplytoadriverifsection58(1)applies to the driver.60Proceeding through a red traffic
arrowIf traffic arrows at an intersection or
marked foot crossing areshowingaredtrafficarrow,andadriveristurningintheReprint 2C effective 30 November
2012Page 57
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 6 Traffic lights, traffic arrows
and twin red lights[s 60A]direction
indicated by the arrow, the driver must not enter theintersection or marked foot crossing.Maximum penalty—20 penalty units.60AProceeding through a bicycle storage
area before a redtraffic light or arrow(1)If
there is a bicycle storage area before traffic lights that
areshowing a red traffic light, a driver of a
motor vehicle mustnot allow any part of the vehicle to enter
the bicycle storagearea.Maximum
penalty—20 penalty units.(2)If there is a
bicycle storage area before traffic arrows that areshowing a red traffic arrow, and a driver of
a motor vehicle isturning in the direction indicated by the
arrow, the driver mustnot allow any part of the vehicle to
enter the bicycle storagearea.Maximum
penalty—20 penalty units.61Proceeding when
traffic lights or arrows at anintersection
change to red or yellow(1)This section
applies to a driver—(a)atanintersectionwithtrafficlightsshowingagreentraffic light
who has stopped after the stop line, stop hereon red signal
sign, or nearest or only traffic lights, at theintersectionandisnotmakingahookturnattheintersection;
or(b)atanintersectionwithtrafficarrowsshowingagreentraffic arrow
who is turning in the direction indicated bythe arrow and
has stopped after the stop line, stop hereon red arrow
sign, or nearest or only traffic arrows, atthe
intersection.Example—A
driver may stop after the stop line at an intersection with traffic
lightsshowing a green traffic light, and not
proceed through the intersection,because traffic
is congested.Page 58Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 6 Traffic
lights, traffic arrows and twin red lights[s 62](2)If the traffic lights or arrows change
to red or yellow while thedriverisstoppedandthedriverhasnotenteredtheintersection, the driver must not enter the
intersection.Maximum penalty—20 penalty units.(3)However, if the traffic lights are at
an intersection with a leftturn on red
after stopping sign and the driver is turning left atthe
intersection, the driver may turn left after stopping.(4)Also, subsection (2) does not apply to
a driver if section 58(1)applies to the driver.(5)If the traffic lights or arrows change
to red or yellow while thedriver is stopped and the driver has
entered the intersection,the driver must leave the intersection
as soon as the driver cando so safely.Maximum
penalty—20 penalty units.Division 2Giving way at
traffic lights andtraffic arrows62Giving way when turning at intersection with
traffic lights(1)A driver turning at an intersection
with traffic lights must giveway to—(a)any pedestrian at or near the
intersection who is on theroad the driver is entering;
and(b)ifthedriveristurningleftataleftturnonredafterstopping sign at
the intersection—(i)anyvehicleapproachingfromtheright,turningright at the intersection into the road the
driver isentering,ormakingaU-turnattheintersection;and(ii)any pedestrian
at or near the intersection who is onthe road the
driver is leaving; andReprint 2C effective 30 November
2012Page 59
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 6 Traffic lights, traffic arrows
and twin red lights[s 62](c)if
the driver is turning right—any oncoming vehicle thatis
going straight ahead or turning left at the intersection(except a vehicle turning left using a slip
lane).Maximum penalty—20 penalty units.(2)However, a driver who is turning at an
intersection with trafficarrows showing a green traffic arrow
need not give way to anoncomingvehicleifthedriveristurninginthedirectionindicated by the
green traffic arrow.Examples—Example 1Giving
way to a pedestrian on the road thedriver is
enteringExample 2Driver turning
right giving way to anoncoming vehicle going straight
aheadPage 60Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 6 Traffic
lights, traffic arrows and twin red lights[s 63]Example 3Driver turning
right does not have to give way to an oncoming vehicle that is
turningleft into the road the driver is entering
using a slip laneIn example 1, the vehicle must give way to
the pedestrian.In examples 2 and 3, vehicle B must give way
to vehicle A.63Giving way at an intersection with
traffic lights notoperating or only partly operating(1)This section applies to a driver at an
intersection if—(a)traffic lights at the intersection are
not operating; or(b)thetrafficlightsareshowingonlyaflashingyellowtraffic light.(2)If
there is a traffic light-stop sign at the intersection, the
drivermust comply with section 67 as if the sign
were a stop sign atan intersection without traffic
lights.Maximum penalty—20 penalty units.(3)Ifthereisnotrafficlight-stopsignattheintersection,thedriver must give way to vehicles and
pedestrians at or near theintersectioninaccordancewithsection72or73asiftheintersectionwereanintersectionwithouttrafficlightsorastop sign, stop
line, give way sign or give way line.Maximum
penalty—20 penalty units.Reprint 2C effective 30 November
2012Page 61
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 6 Traffic lights, traffic arrows
and twin red lights[s 64]Example—Traffic light-stop sign(4)Subsection(3)doesnotapplyiftheintersectionisaroundabout.(5)Iftheintersectionisaroundabout,thedrivermustcomplywith section
114.64Giving way at a flashing yellow
traffic arrow at anintersectionA driver turning
in the direction indicated by a flashing yellowtrafficarrowatanintersectionwithtrafficlightsmustgiveway
to—(a)any vehicle travelling on the road the
driver is entering;and(b)any pedestrian
at or near the intersection who is on theroad the driver
is entering; and(c)if the driver is turning right—any
oncoming vehicle thatis going straight ahead or turning
left at the intersection(except a vehicle turning left using a
slip lane).Maximum penalty—20 penalty units.65Giving way at a marked foot crossing
(except at anintersection) with a flashing yellow traffic
light(1)This section applies to a driver
approaching or at a markedfoot crossing (except at or near an
intersection) with a flashingyellow traffic
light at the crossing.(2)The driver
must—Page 62Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 6 Traffic
lights, traffic arrows and twin red lights[s 66](a)give way to any pedestrian on the
crossing; and(b)not obstruct any pedestrian on the
crossing; and(c)notovertakeorpassavehiclethatistravellinginthesamedirectionasthedriverandisstopping,orhasstopped, to give
way at the crossing.Maximum penalty—20 penalty
units.(3)If there is no pedestrian on the
crossing, and no other vehicletravelling in
the same direction as the driver that is stopping,or
has stopped, to give way at the crossing, the driver mayproceed through the crossing.Division 3Twin red lights
(except at levelcrossings)66Stopping for twin red lights (except at
level crossings)(1)A driver approaching or at twin red
lights on a road (except ata level
crossing) must stop in accordance with subsections (2)and
(3).Maximum penalty—20 penalty units.(2)If there is a stop line at or near the
lights and the driver canstop safely before reaching the stop
line, the driver must stopas near as practicable to, but before
reaching, the stop line.(3)If there is no
stop line at or near the lights and the driver canstop
safely before reaching the lights, the driver must stop asnear
as practicable to, but before reaching, the lights.(4)If the driver stops for the lights,
the driver must not proceeduntil the lights
are not showing.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
63
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 67]Part
7Giving wayDivision 1Giving way at a stop sign, stop line,give
way sign or give way lineapplying to the driver67Stopping and giving way at a stop sign
or stop line at anintersection without traffic lights(1)Thissectionappliestoadriveratanintersectionwithouttraffic lights who is facing a stop sign or
stop line.(2)Thedrivermuststopasnearaspracticableto,butbeforereaching—(a)the stop line; or(b)if
there is no stop line—the intersection.Maximum
penalty—20 penalty units.(3)Thedrivermustgivewaytoavehiclein,enteringorapproaching the intersection except—(a)an oncoming vehicle turning right at
the intersection, ifastopsign,stopline,givewaysignorgivewaylineapplies to the
driver of the oncoming vehicle; or(b)a
vehicle turning left at the intersection using a slip lane;or(c)a vehicle making
a U-turn.Maximum penalty—20 penalty units.(4)If the driver is turning left or right
or making a U-turn, thedrivermustalsogivewaytoanypedestrianatorneartheintersectionontheroad,orpartoftheroad,thedriverisentering.Maximum
penalty—20 penalty units.Page 64Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 67](5)For
this section, an oncoming vehicle proceeding through aT-intersectiononthecontinuingroadistakennottobeturning.Examples—Example 1Stop
signExample 2Stop lineExample 3Example 4Stopping and giving way at a stop sign
toStopping and giving way at a stop sign
tovehicles on the left and rightan
oncoming vehicle at a stop signIn example 3,
vehicle B must stop and give way to each vehicle A.Reprint 2C effective 30 November 2012Page
65
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 68]Example 5Stopping and
giving way at a stop sign to an oncoming vehicle that is not at a
stopsign or give way signIn examples 4 and
5, vehicle B must stop and give way to vehicle A.68Stopping and giving way at a stop sign
or stop line atother places(1)This
section applies to a driver approaching or at a place witha
stop sign or stop line, unless the place is—(a)an
intersection; or(b)a children’s crossing; or(c)an area of a road that is not a
children’s crossing onlybecause it does not have—(i)children crossing flags; or(ii)children’s
crossing signs and twin yellow lights; or(d)a
level crossing; or(e)a place with twin red lights.Page
66Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 68]Examples—•a stop sign at a
break in a dividing strip dividing the part of the roadused
by the main body of moving vehicles from a service road•a stop sign on an exit from a carpark
where the exit joins the road(2)Thedrivermuststopasnearaspracticableto,butbeforereaching—(a)the stop line; or(b)if
there is no stop line—the stop sign.Maximum
penalty—20 penalty units.(3)The driver must
give way to any vehicle or pedestrian at ornear the stop
line or stop sign.Maximum penalty—20 penalty units.Examples—Example 1Stopping and giving way at a stop sign at
abreak in a dividing stripExample 2Stopping and giving way at a stop
signwhere a carpark exit joins a roadIn
each example, vehicle B must stop and give way to vehicle A.Reprint 2C effective 30 November 2012Page
67
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 69]69Giving way at a give way sign or give
way line at anintersection, other than a roundabout(1)This section applies to a driver at an
intersection, other than aroundabout, who is facing a give way
sign or give way line.(2)Unless the
driver is turning left using a slip lane, the drivermustgivewaytoavehiclein,enteringorapproachingtheintersection except—(a)an
oncoming vehicle turning right at the intersection, ifastopsign,stopline,givewaysignorgivewaylineapplies to the
driver of the oncoming vehicle; or(b)a
vehicle turning left at the intersection using a slip lane;or(c)a vehicle making
a U-turn.Maximum penalty—20 penalty units.(2A)If the driver is
turning left using a slip lane, the driver mustgive way
to—(a)a vehicle, other than a vehicle making
a U-turn at theintersection, that is—(i)on
the road that the driver is entering; or(ii)turning right at the intersection into the
road thatthe driver is entering; and(b)a vehicle or a pedestrian on the slip
lane.Maximum penalty—20 penalty units.(3)If the driver is turning left or right
or making a U-turn, thedrivermustalsogivewaytoanypedestrianatorneartheintersectionontheroad,orpartoftheroad,thedriverisentering.Maximum
penalty—20 penalty units.(5)For this
section, an oncoming vehicle proceeding through aT-intersectiononthecontinuingroadistakennottobeturning.Page
68Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 69]Examples—Example 1Give way
signExample 2Give way
lineExample 3Giving way at a
give way sign to vehicleson the left and rightExample 4Giving way at a
give way sign to anoncoming vehicle at a give way signReprint 2C effective 30 November 2012Page
69
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 69A]Example 5Givingwayatagivewaysigntoanoncoming vehicle
that is not at a stop signor give way signExample 6Driver turning right at a give way
linedoes not have to give way to a
vehicleturning left using a slip laneIn
example 3, vehicle B must give way to each vehicle A.In
examples 4, 5 and 6, vehicle B must give way to vehicle A.69ATwo or more drivers facing various
signs or lines at anintersectionIf 2 or more
drivers at an intersection are each facing a stopsign,stopline,givewaysignorgivewayline,eachdrivermustgivewaytotheotherorothers,asrequiredunderdivision 2, as if none of the drivers were
facing a stop sign,stop line, give way sign or give way
line.Maximum penalty—20 penalty units.70Giving way at a give way sign at a
bridge or length ofnarrow roadA driver
approaching a bridge or length of narrow road with agive
way sign must give way to any oncoming vehicle that ison
the bridge or length of road when the driver reaches thesign.Maximum
penalty—20 penalty units.Page 70Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 71]Examples—Example 1Giving way at a
bridgeExample 2Giving way at a
length of narrow roadIn each example, vehicle B must give
way to vehicle A.71Giving way at a give way sign or give
way line at otherplaces(1)Adriverapproachingorataplace(exceptanintersection,bridge or length
of narrow road, level crossing, or a place withtwin red lights)
with a give way sign or give way line mustgive way in
accordance with this section.Maximum
penalty—20 penalty units.Examples—•a give way sign at a break in a
dividing strip dividing the part of theroad used by the
main body of moving vehicles from a service roadReprint 2C effective 30 November 2012Page
71
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 72]•a give way sign on a road at a place
where a bicycle path meets theroad(2)The driver must give way to any
vehicle or pedestrian at ornear the give
way sign or give way line.Examples—Example 1Giving
way at a give way sign at a break ina dividing
stripExample 2Giving way at a
give way sign where abicycle path meets a roadIn
example 1, vehicle B must give way to vehicle A.In
example 2, the motor vehicle must give way to the bicycle.Division 2Giving way at an
intersectionwithout traffic lights or a stop
sign,stop line, give way sign or give wayline72Giving way at an
intersection (except a T-intersection orroundabout)(1)Adriveratanintersection(exceptaT-intersectionorroundabout) who is not facing traffic lights
or a stop sign, stopline,givewaysign,orgivewayline,mustgivewayinaccordance with this section.Page
72Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 72]Maximum
penalty—20 penalty units.(2)If the driver is
going straight ahead, the driver must give wayto any vehicle
approaching from the right (except a vehicleapproaching or
at a place with a stop sign, stop line, give waysign, or give way line).Examples—Example 1Driver going
straight ahead givingway to a vehicle on the right that
isgoing straight aheadExample 2Driver going straight ahead givingway
to a vehicle on the rightthat is turning rightIn
each example, vehicle B must give way to vehicle A.(3)If the driver is turning left (except
if the driver is using a sliplane), the
driver must give way to—(a)any vehicle
approaching from the right (except a vehicleapproaching or
at a place with a stop sign, stop line, giveway sign, or
give way line); and(b)any pedestrian at or near the
intersection on the road thedriver is
entering.Reprint 2C effective 30 November 2012Page
73
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 72]Examples—Example 3Driver
turning left giving way to a vehicleon the right that
is going straight aheadExample 4Driver turning
left giving way to apedestrian on the road the driver isenteringIn example 3,
vehicle B must give way to vehicle A.In example 4, the
vehicle must give way to the pedestrian.(4)If
the driver is turning left using a slip lane, the driver
mustgive way to—(a)any
vehicle approaching from the right or turning rightattheintersectionintotheroadthedriverisentering(except a
vehicle making a U-turn at the intersection);and(b)any pedestrian on the slip
lane.Page 74Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 72]Example—Example 5Driver turning
left using a slip lane giving way to a vehicle that is turning
right intothe road the driver is enteringIn
this example, vehicle B must give way to vehicle A.(5)If the driver is turning right, the
driver must give way to—(a)any vehicle
approaching from the right (except a vehicleapproaching or
at a place with a stop sign, stop line, giveway sign, or
give way line); and(b)anyoncomingvehiclethatisgoingstraightaheadorturning left at the intersection (except a
vehicle turningleftusingasliplaneoravehicleapproachingorataplace with a
stop sign, stop line, give way sign, or giveway line);
and(c)any pedestrian at or near the
intersection on the road thedriver is
entering.Reprint 2C effective 30 November 2012Page
75
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 72]Examples—Example 6Driver
turning right giving way to avehicle on the
right that is turning rightinto the road the driver is
leavingExample 7Driver turning
right giving way to anoncoming vehicle that is going
straightahead on the road the driver is
leavingIn examples 6 and 7, vehicle B must give way
to vehicle A.Page 76Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 73]Example 8Driverturningrightgivingwaytoanoncoming vehicle that is turning left
intothe road the driver is enteringExample 9Driver turning
right giving way to apedestrian on the road the driver
isenteringIn example 8,
vehicle B must give way to vehicle A.In example 9, the
vehicle must give way to the pedestrian.73Giving way at a T-intersection(1)A driver at a T-intersection who is
not facing traffic lights or astop sign, stop
line, give way sign, or give way line, must giveway
in accordance with this section.Maximum
penalty—20 penalty units.(2)If the driver is
turning left (except if the driver is using a sliplane) or right from the terminating road
into the continuingroad, the driver must give way to—(a)any vehicle travelling on the
continuing road except—(i)avehicleapproachingorataplacewithastopsign, stop line,
give way sign, or give way line; or(ii)a
vehicle making a U-turn on the continuing roadat the
T-intersection; andReprint 2C effective 30 November 2012Page
77
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 73](b)anypedestrianonthecontinuingroadatorneartheintersection.Examples—Example 1Driver turning
right from the terminatingroad giving way to a vehicle on
thecontinuing roadExample 2Driver turning left (except if the
driveris using a slip lane) from the
terminatingroad giving way to a pedestrian on
thecontinuing roadIn example 1,
vehicle B must give way to vehicle A.In example 2, the
vehicle must give way to the pedestrian.(3)If
the driver is turning left from the terminating road into
thecontinuing road using a slip lane, the
driver must give wayto—(a)any
vehicle travelling on the continuing road (except avehicle making a U-turn on the continuing
road at theT-intersection); and(b)any
pedestrian on the slip lane.(4)If
the driver is turning left (except if the driver is using a
sliplane) from the continuing road into the
terminating road, thedrivermustgivewaytoanypedestrianontheterminatingroad at or near
the intersection.Page 78Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 73]Example—Example 3Driver turning
left (except if the driver is using a slip lane) from the
continuing roadgiving way to a pedestrian on the
terminating roadIn this example, the vehicle must give way to
the pedestrian.(5)Ifthedriveristurningfromthecontinuingroadintotheterminating road using a slip lane, the
driver must give wayto—(a)any
vehicle approaching from the right (except a vehiclemakingaU-turnfromtheterminatingroadattheT-intersection);
and(b)any pedestrian on the slip
lane.(6)If the driver is turning right from
the continuing road into theterminating
road, the driver must give way to—(a)anyoncomingvehiclethatistravellingthroughtheintersection on the continuing road or
turning left at theintersection (except a vehicle approaching
or at a placewith a stop sign, stop line, give way sign,
or give wayline); and(b)anypedestrianontheterminatingroadatorneartheintersection.Reprint 2C
effective 30 November 2012Page 79
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 73]Examples—Example 4Driver
turning right from the continuingroad giving way to
an oncoming vehicletravelling through the intersection on
thecontinuing roadExample 5Driver leaving the continuing road togo
straight ahead on the terminatingroad giving way
to a vehicle goingthrough the intersection on thecontinuing roadExample 5 shows a
T-intersection where the continuing road (marked with broken
whitelines)goesaroundacorner.VehicleBisleavingthecontinuingroadtoentertheterminating road. In examples 4 and 5,
vehicle B must give way to vehicle A.Page 80Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 73]Example 6Driver
turning right from the continuingroad giving way to
an oncoming vehicleturning left from the continuing roadExample 7Driver turning
right from thecontinuing road giving way to apedestrian on the terminating roadIn
example 6, vehicle B must give way to vehicle A.In
example 7, the vehicle must give way to the pedestrian.(7)In this section—(a)turningleftfromthecontinuingroadintotheterminatingroad,foradriver,includes,wherethecontinuing road curves to the right at a
T-intersection,leavingthecontinuingroadtoproceedstraightaheadonto the
terminating road; and(b)turningrightfromthecontinuingroadintotheterminatingroad,foradriver,includes,wherethecontinuingroadcurvestotheleftataT-intersection,leavingthecontinuingroadtoproceedstraightaheadonto the
terminating road.Reprint 2C effective 30 November 2012Page
81
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 74]Division 3Entering or
leaving road-relatedareas and adjacent land74Giving way when entering a road from a
road-related areaor adjacent land(1)A
driver entering a road from a road-related area, or adjacentland, without traffic lights or a stop sign,
stop line, give waysign or give way line must give way to all
of the following—(a)a vehicle travelling on the road or
turning into the road,exceptavehicleturningrightintotheroadfromaroad-related area or adjacent
land;(b)a pedestrian on the road;(c)a vehicle or a pedestrian on a
road-related area that thedriver crosses to enter the
road;(d)for a driver entering the road from a
road-related area—(i)a pedestrian on the road-related area;
and(ii)anothervehicleaheadofthedriver’svehicleorapproaching from the left or right.Maximum penalty—20 penalty units.(2)In this section—roaddoes
not include a road-related area.Page 82Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 75]Example—Driver
entering a road from a road-related area giving way to a pedestrian
on thefootpath and a vehicle on the roadIn
this example, vehicle B must give way to the pedestrian on the
footpath and to vehicleA.75Giving way when entering a road-related area
or adjacentland from a road(1)A
driver entering a road-related area or adjacent land from aplace on a road without traffic lights or a
stop sign, stop line,give way sign or give way line must
give way to—(a)any pedestrian on the road; and(b)any vehicle or pedestrian on any
road-related area thatthe driver crosses or enters;
and(c)ifthedriveristurningrightfromtheroad—anyoncomingvehicleontheroadthatisgoingstraightahead or turning left; and(d)if the road the driver is leaving ends
at a T-intersectionopposite the road-related area or adjacent
land and thedriver is crossing the continuing road—any
vehicle onthe continuing road.Maximum
penalty—20 penalty units.Reprint 2C effective 30 November
2012Page 83
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 76](2)In this section—roaddoes
not include a road-related area.Examples—Example 1Driver turning
right from a road intoa road-related area giving way to
anoncoming vehicle that is goingstraight ahead and to a pedestrian onthe
footpathExample 2Driver crossing a
continuing road at aT-intersection to enter a road-related
areagiving way to a vehicle on the
continuingroadIn each example, vehicle B must give
way to vehicle A. In example 1, vehicle B must alsogive
way to the pedestrian on the footpath.Division 4Keeping clear of and giving way toparticular vehicles76Keeping clear of trams travelling in tram
lanes etc.(1)A driver must not move into the path
of an approaching tramtravelling in a tram lane, or on tram
tracks marked along theleft side of the tracks by a broken or
continuous yellow lineparallel to the tracks.Maximum penalty—20 penalty units.Page
84Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 77](2)If a
driver is in the path of an approaching tram travelling in atram
lane, or on tram tracks marked along the left side of thetracks by a broken or continuous yellow line
parallel to thetracks, the driver must move out of the path
of the tram assoon as the driver can do so safely.Maximum penalty—20 penalty units.(3)In this section—tramincludes a bus travelling along tram
tracks.77Giving way to buses(1)A driver driving on a length of road
in a built-up area wherethe speed limit applying to the driver
is not more than 70km/h,in the left lane or left line of
traffic, or in a bicycle lane on thefar left side of
the road, must give way to a bus in front of thedriver if—(a)the
bus has stopped, or is moving slowly, at the far leftside
of the road or in a bus-stop bay; and(b)the
bus displays a give way to buses sign and the rightdirection indicator lights of the bus are
operating; and(c)the bus is about to enter or proceed
in the lane or line oftraffic in which the driver is
driving.Maximum penalty—20 penalty units.(2)In this section—left lane, of
a road, means—(a)the marked lane nearest to the far
left side of the road(thefirst
lane) or, if the first lane is a bicycle lane,
themarked lane next to the first lane;
or(b)if there is an obstruction in the
first lane (for example, aparkedcarorroadworks)andthefirstlaneisnotabicycle lane—the marked lane next to the
first lane.left line of traffic, for a road,
means the line of traffic nearestto the far left
side of the road.Reprint 2C effective 30 November 2012Page
85
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 78]Example—Give way to buses
sign78Keeping clear of police and emergency
vehicles(1)A driver must not move into the path
of an approaching policeor emergency vehicle that is
displaying a flashing blue or redlight(whetherornotitisalsodisplayingotherlights)orsounding an alarm.Maximum
penalty—20 penalty units.(2)Ifadriverisinthepathofanapproachingpoliceoremergencyvehiclethatisdisplayingaflashingblueorredlight(whetherornotitisalsodisplayingotherlights)orsounding an alarm, the driver must move out
of the path of thevehicle as soon as the driver can do so
safely.Maximum penalty—20 penalty units.(3)This section applies to the driver
despite any other section ofthis
regulation.79Giving way to police and emergency
vehicles(1)A driver must give way to a police or
emergency vehicle thatis displaying a flashing blue or red
light (whether or not it isalso displaying
other lights) or sounding an alarm.Maximum
penalty—20 penalty units.(2)This section
applies to the driver despite any other section thatwould otherwise require the driver of a
police or emergencyvehicle to give way to the driver.Page
86Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 79A]79AGiving way to escorted vehicles(1)A driver must give way to an oversize
vehicle that is beingescorted by a pilot or escort
vehicle.Maximum penalty—20 penalty units.(2)This section applies to the driver
despite any other section thatwould otherwise
require the driver of an oversize vehicle togive way to the
driver.Division 5Crossings and
shared zones80Stopping at a children’s
crossing(1)Adriverapproachingachildren’scrossingmustdriveataspeed at which
the driver can, if necessary, stop safely beforethe
crossing.Maximum penalty—20 penalty units.(2)A driver approaching or at a
children’s crossing must stop asnear as
practicable to, but before reaching, the stop line at thecrossing if—(a)a
hand-held stop sign is displayed at the crossing; or(b)a pedestrian is on or entering the
crossing.Maximum penalty—20 penalty units.(3)If a driver stops at a children’s
crossing for a hand-held stopsign, the driver
must not proceed until there is no pedestrianon or entering
the crossing and the holder of the sign—(a)no
longer displays the sign towards the driver; or(b)otherwise indicates that the driver may
proceed.Maximum penalty—20 penalty units.(4)If a driver stops at a children’s
crossing for a pedestrian, thedrivermustnotproceeduntilthereisnopedestrianonorentering the crossing.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
87
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 80](5)For this section, if a children’s
crossing extends across a roadwithadividingstrip,thepartofthechildren’scrossingoneachsideofthedividingstripistakentobeaseparatechildren’s crossing.(6)Achildren’s crossingis
an area of a road—(a)at a place with stop lines marked on
the road, and—(i)children crossing flags; or(ii)children’scrossingsignsandtwinyellowlights;and(b)indicated by—(i)2
red and white posts erected on each side of theroad; or(ii)2 parallel
continuous or broken lines on the roadsurface from 1
side of the road completely or partlyacross the road;
and(c)extending across the road between the
posts or lines.Examples—Children crossing
flagPage 88Children’s
crossing signReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 81]Hand-held stop
signsExample 1Driver stopped at
stop line forpedestrians on a children’s crossingwith
children crossing flagsExample 2Driver stopped at
stop line forpedestrians on a children’s crossing
withchildren’s crossing signs and twinyellow lightsIneachoftheseexamples,thedrivermuststopatthestoplinebecausetherearepedestrians on the children’s
crossing.81Giving way at a pedestrian
crossing(1)Adriverapproachingapedestriancrossingmustdriveataspeed at which
the driver can, if necessary, stop safely beforethe
crossing.Reprint 2C effective 30 November 2012Page
89
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 81]Maximum penalty—20 penalty units.(2)Adrivermustgivewaytoanypedestrianonapedestriancrossing.Maximum penalty—20 penalty units.(3)Apedestrian
crossingis an area of a road—(a)at a
place with white stripes on the road surface that—(i)run lengthwise along the road;
and(ii)are of
approximately the same length; and(iii)are
approximately parallel to each other; and(iv)areinarowthatextendscompletely,orpartly,across the road;
and(b)with or without either or both of the
following—(i)a pedestrian crossing sign;(ii)alternating
flashing twin yellow lights.Examples—Pedestrian crossing signPage 90Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 82]Example 1Givingwaytoapedestrianonapedestrian
crossingExample 2Giving way to a
pedestrian on apedestrian crossing at a slip laneIn
each of these examples, the driver must give way to the pedestrian
on the crossing.82Overtaking or passing a vehicle at a
children’s crossingor pedestrian crossingAdriverapproachingachildren’scrossing,orpedestriancrossing, must
not overtake or pass a vehicle that is travellinginthesamedirectionasthedriverandisstopping,orhasstopped, to give way to a pedestrian
at the crossing.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
91
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 83]Example—Driver not
passing a vehicle that has stopped to give way to a pedestrian at
apedestrian crossingIn the example,
vehicle A has stopped to give way to a pedestrian on the crossing.
VehicleB must not overtake or pass vehicle A.83Giving way to pedestrians in a shared
zoneAdriverdrivinginasharedzonemustgivewaytoanypedestrian in
the zone.Maximum penalty—20 penalty units.Division 6Other give way
rules84Giving way when driving through a
break in a dividingstrip(1)If a
driver drives through a break in a dividing strip that has
nostop sign, stop line, give way sign or give
way line, the drivermust give way to—(a)any
tram on the dividing strip; andPage 92Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 84](b)any
vehicle travelling on the part of the road the driver isentering (except a vehicle to which a stop
sign, stop line,give way sign, or give way line,
applies).Maximum penalty—20 penalty units.(2)In this section—tramincludes a bus travelling along tram
tracks.Examples—Example 1Giving
way when driving through abreak in a median stripExample 2Giving way when
driving through a breakin a dividing strip to leave a service
roadReprint 2C effective 30 November 2012Page
93
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 85]Example 3Giving way when
driving through a break in a dividing strip to enter a service
roadIn each of the examples, vehicle B must give
way to vehicle A.85Giving way on a painted islandA
driver entering a turning lane from a painted island mustgive
way to any vehicle—(a)in the turning lane; or(b)entering the turning lane from the
marked lane, or lineof traffic, immediately adjacent to
the turning lane.Maximum penalty—20 penalty units.Page
94Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 7 Giving
way[s 86]Examples—Example 1Driver entering a
turning lane from apainted island giving way to a vehicleentering the turning lane from themarked
lane immediately to the right ofthe turning
laneExample 2Driver entering a
turning lane from apainted island giving way to a
vehicleentering the turning lane from the
markedlane immediately to the left of the
turninglaneIn the examples, vehicle B must give
way to vehicle A.86Giving way in median turning
bays(1)A driver entering a median turning bay
must give way to anyoncoming vehicle already in the
turning bay.Maximum penalty—20 penalty units.(2)In this section—medianturningbaymeansamarkedlane,orthepartofamarked
lane—(a)to which a median turning lane sign
applies; or(b)where traffic lane arrows applying to
the lane indicatethat vehicles travelling in opposite
directions must turnright.Reprint 2C
effective 30 November 2012Page 95
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 7 Giving way[s 87]Examples—Example 1Median
turning lane signExample 2Giving way in a
median turning bayIn example 2, vehicle B must give way to
vehicle A.87Giving way when moving from a side of
a road or amedian strip parking area(1)A driver entering a marked lane, or a
line of traffic, from thefar left or right side of a road must
give way to any vehicletravelling in the lane or line of
traffic.Maximum penalty—20 penalty units.(2)However, the driver of a bus does not
have to give way to avehicle if—(a)the
driver of the vehicle is required to give way to thebus
under section 77; and(b)it is safe for
the bus to enter the lane or line of traffic inwhich the
vehicle is driving.(3)Adriverturningfromamedianstripparkingareaintoamarked lane, or a line of traffic, must give
way to any vehicletravelling in the lane or line of
traffic.Maximum penalty—20 penalty units.Page
96Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 88](4)In
this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Part 8Traffic signs and road markingsDivision 1Traffic signs
and road markings atintersections and other places88Left turn signs(1)If
there is a left turn only sign at an intersection, a driver
mustturn left at the intersection.Maximum penalty—20 penalty units.(2)If there is a left lane must turn left
sign at an intersection, adriverwhoisintheleftmarkedlanewhenenteringtheintersection must turn left at the
intersection.Maximum penalty—20 penalty units.Examples—Left turn only
signReprint 2C effective 30 November 2012Left
lane must turn left signPage 97
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 89]89Right
turn signs(1)If there is a right turn onlysignatanintersection,adrivermust turn right
at the intersection.Maximum penalty—20 penalty
units.(2)If there is a right lane must turn
right sign at an intersection, adriverwhoisintherightmarkedlanewhenenteringtheintersection must turn right at the
intersection.Maximum penalty—20 penalty units.(3)In this section—turn
rightdoes not include make a U-turn.Examples—Right turn only
signRight lane must turn right sign90No turns signsIf there is a no
turns sign at an intersection, a driver must notturn
left or right, or make a U-turn, at the intersection.Maximum penalty—20 penalty units.Page
98Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 91]Example—No
turns sign91No left turn and no right turn
signs(1)Ifthereisanoleftturnsignatanintersection,oranotherplace on a road,
a driver must not turn left at the intersectionor place.Maximum penalty—20 penalty units.(2)If there is a no right turn sign at an
intersection, or anotherplace on a road, a driver must not
turn right or make a U-turnat the
intersection or place.Maximum penalty—20 penalty
units.Examples of no left turn signs—No
left turn sign (Standard sign)No left turn sign
(Variable illuminatedmessage sign)Reprint 2C
effective 30 November 2012Page 99
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 92]Examples of no
right turn signs—No right turn sign (Standard sign)No
right turn sign (Variableilluminated message sign)(3)However, a driver may make a U-turn at
the intersection orplace if there is a U-turn permitted sign at
the intersection orplace.92Traffic lane arrows(1)Ifadriverisdrivinginamarkedlaneatanintersection(exceptaroundabout)andtherearetrafficlanearrowsapplying to the
lane, the driver must—(a)ifthearrowsindicateasingledirection—driveinthatdirection;
or(b)if the arrows indicate 2 or more
directions—drive in 1 ofthose directions.Maximum
penalty—20 penalty units.(2)However, this
section does not apply to a driver if—(a)the
arrows indicate a direction to the right (whether ornottheyalsoindicateanotherdirection)atanintersectionandthedriverismakingaU-turnattheintersection; or(b)atrafficsignindicatesthatthedrivermaydriveinadirectiondifferenttothatindicatedbythetrafficlanearrows;
or(c)the driver is driving in the direction
indicated by trafficlane arrows that apply to 1 or more
marked lanes andthere is an obstruction in each of those
lanes; orPage 100Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 93](d)thedriveristurningatanintersectioninaccordancewith section
28(2) or 32(2).Examples—Example 1Traffic lane arrows on the surface ofmarked
lanesExample 2Traffic lane
arrows on a traffic sign(3)The existence of
a bicycle storage area in a marked lane doesnot alter a
driver’s obligation to comply with this section.Division 2Traffic signs
and road markingsgenerally93No
overtaking or passing signs(1)A
driver must not—(a)drivepastanoovertakingorpassingsignifanyoncoming vehicle
is on the bridge or length of road towhich the sign
applies; or(b)overtake a vehicle on a bridge or
length of road to whicha no overtaking or passing sign
applies.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
101
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 94](2)A no
overtaking or passing sign on a road applies to the lengthof
road (including a length of road on a bridge) beginning atthe
sign and ending—(a)ifinformationonorwiththesignindicatesadistance—at that distance past the
sign; or(b)if the sign applies to a bridge—at the
end of the bridge;or(c)at an end no
overtaking or passing sign on the road.Examples—No
overtaking or passing signEnd no overtaking or passing
sign94No overtaking on bridge signsA
driver on a bridge with a no overtaking on bridge sign mustnot
overtake a vehicle between the sign and the far end of thebridge.Maximum
penalty—20 penalty units.Page 102Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 95]Example—No
overtaking on bridge sign95Emergency
stopping lane only signs(1)Adrivermustnotdriveinanemergencystoppinglaneunless—(a)the driver needs to drive in the
emergency stopping laneto avoid a collision, to stop in the
lane, or because thedriver’s vehicle is disabled;
or(b)thedriverispermittedtodriveintheemergencystopping lane
under another section.Maximum penalty—20 penalty
units.(2)This section does not apply to the
rider of a bicycle.(3)In this regulation—emergency stopping lanemeans a marked
lane, or the part ofa marked lane, to which an emergency
stopping lane only signapplies.Reprint 2C
effective 30 November 2012Page 103
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 96]Example—Emergency stopping lane only sign96Keep clear markings(1)A driver must not stop on an area of a
road marked with akeep clear marking.Maximum
penalty—20 penalty units.(2)In this
section—keepclearmarkingmeansthewords‘keepclear’markedacross all or part of a road, with or
without continuous linesmarked across all or part of the
road.Examples—Keep clear marking
bounded by line roadmarkingsKeep clear
marking with no line roadmarkingsPage 104Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 97]97Road
access signs(1)A driver must not drive on a length of
road to which a roadaccess sign applies if information on
or with the sign indicatesthat the driver or the driver’s
vehicle is not permitted beyondthe sign.Maximum penalty—20 penalty units.(2)Aroadaccesssignonaroadappliestothelengthofroadbeginningatthesign(includinganyroadintowhichthelength of road merges) and ending—(a)if the sign is on a freeway—at an end
freeway sign orend road access sign on the road; or(b)ifthesignisnotonafreeway—atthenearerofthefollowing—(i)iftheroadendsataT-intersectionordeadend—the end of
the road;(ii)an end road
access sign on the road.Examples—A
road access sign on an access ramp to a freeway applies to the
accessramp and the freeway into which the access
ramp merges.Road access signReprint 2C
effective 30 November 2012End freeway signPage
105
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 98]End road access
sign98One-way signs(1)Adrivermustnotdriveonalengthofroadtowhichaone-way sign applies except in the direction
indicated by thearrow on the sign.Maximum
penalty—20 penalty units.(2)Aone-waysignonaroadappliestothelengthofroadbeginningatthesignandendingatthenearerofthefollowing—(a)a
two-way sign on the road;(b)a keep left sign
on the road;(c)another sign or road marking on the
road that indicatesthat the road is a two-way road;(d)if the road ends at a
T-intersection—the end of the road.(3)This
section does not apply to the rider of a motorbike that is apostal vehicle, the rider of a bicycle or
the rider of an animal ifthe rider—(a)isridingonafootpath,naturestriporsharedpathadjacent to the length of road; and(b)ispermittedtorideonthefootpath,naturestriporshared path under this regulation.Page
106Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 99]Examples—One-way signTwo-way
sign99Keep left and keep right signs(1)A driver driving past a keep left sign
must drive to the left ofthe sign.Maximum
penalty—20 penalty units.(2)A driver driving
past a keep right sign must drive to the rightof the
sign.Maximum penalty—20 penalty units.(3)This section does not apply to the
rider of a motorbike that is apostal vehicle,
the rider of a bicycle or the rider of an animal ifthe
rider—(a)is riding on a footpath, nature strip
or shared path; and(b)ispermittedtorideonthefootpath,naturestriporshared path under this regulation.Reprint 2C effective 30 November 2012Page
107
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 100]Examples—Keep left signKeep right
sign100No entry signsA driver must
not drive past a no entry sign.Maximum
penalty—20 penalty units.Example—No
entry sign101Hand-held stop signs(1)A driver approaching a hand-held stop
sign must stop beforereaching the sign.Maximum
penalty—20 penalty units.(2)The driver must
not proceed until the holder of the sign—(a)no
longer displays the sign towards the driver; or(b)otherwise indicates that the driver may
proceed.Maximum penalty—20 penalty units.Page
108Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 101A](3)Thissectiondoesnotapplytoadriverapproachingoratahand-held stop
sign at a children’s crossing.Examples of
hand-held stop signs—101ASafety ramp and
arrester bed signs(1)A driver must not drive on a safety
ramp or arrester bed unlessit is necessary
for the driver to do so in the interests of safety.Maximum penalty—20 penalty units.(2)In this section—arresterbedmeansanareatowhichanarresterbedsignapplies.safetyrampmeansanareatowhichasafetyrampsignapplies.Examples—Arrester bed signSafety ramp
signReprint 2C effective 30 November 2012Page
109
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 102]Division 3Signs for trucks, buses and otherlarge vehicles102Clearance and low clearance signs(1)Adrivermustnotdrivepastaclearancesign,oralowclearancesign,ifthedriver’svehicle,oranyvehicleconnected to it,
is higher than the height (in metres) indicatedby the
sign.Maximum penalty—40 penalty units.(2)In this section—vehicleincludes any load carried by the
vehicle.Examples—Clearance signLow clearance
sign103Load limit signs(1)A
driver must not drive past a bridge load limit (gross mass)sign
or gross load limit sign if the total of the gross mass (intonnes) of the driver’s vehicle, and any
vehicle connected toit, is more than the gross mass
indicated by the sign.Maximum penalty—20 penalty
units.(2)A driver must not drive past a bridge
load limit (mass per axlegroup) sign if the mass (in tonnes)
carried by an axle group ofthe driver’s
vehicle, or any vehicle connected to it, is morethan
the mass indicated by the sign for the axle group.Maximum penalty—20 penalty units.Page
110Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 104](3)In
this section—vehicleincludes any
load carried by the vehicle.Examples—Bridge load limit (gross mass)
signGross load limit signBridge load limit
(mass per axle group) sign104No trucks
signs(1)A driver (except the driver of a bus)
must not drive past a notrucks sign that has information on or
with it indicating a massif the GVM of the driver’s vehicle
(or, if the driver is driving acombination,anyvehicleinthecombination)ismorethanthat
mass.Maximum penalty—20 penalty units.(2)A driver (except the driver of a bus)
must not drive past a notruckssignthathasinformationonorwithitindicatingalength if the length of the driver’s vehicle
(or, if the driver isdrivingacombination,thelengthofthecombination)islonger than that length.Reprint 2C
effective 30 November 2012Page 111
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 104]Maximum
penalty—20 penalty units.(3)The driver of a
truck must not drive past a no trucks sign thathas no
information on or with it indicating a mass or length.Maximum penalty—20 penalty units.(4)It is a defence to a charge under
subsection (1), (2) or (3) forthe driver to
prove—(a)the destination of the driver’s
vehicle was on or near theroad on which the no trucks sign was
located; and(b)the driver—(i)could not reach the vehicle’s destination by
anotherroute; or(ii)couldreachthevehicle’sdestinationbyanotherroute only by
driving past another no trucks sign.(5)Subsections (1) to (3) do not apply to a
driver of a motorisedcaravan on the Brisbane Urban Corridor
or on the part of theIpswichMotorwaybetweenGranardRoadandtheAlbertStreet
pedestrian bridge at Goodna.(6)In
this section—BrisbaneUrbanCorridormeanstheroutebetweenArcherfieldandWishartconsistingofMtGravatt–CapalabaRoad west of the
Gateway Motorway, Kessels Road, RiawenaRoad and Granard
Road.motorised caravanmeans—(a)1vehiclewithaGVMover4.5t,designedmainlyforpeople to live in; or(b)a combination of 2 vehicles with a GVM
over 4.5t if 1of the vehicles is designed mainly for
people to live inand the other has a GVM of less than
4.5t.Page 112Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 105]Example of a no
trucks sign—No trucks sign105Trucks must enter signsIf the driver of
a truck drives past a trucks must enter sign, thedriver must enter the area indicated by
information on or withthe sign.Maximum
penalty—20 penalty units.Example—Trucks must enter sign106No
buses signs(1)The driver of a bus must not drive
past a no buses sign thathas information on or with it
indicating a mass if the GVM ofthe bus is more
than that mass.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
113
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 8 Traffic signs and road
markings[s 107](2)The
driver of a bus must not drive past a no buses sign thathas
information on or with it indicating a length if the bus islonger than that length.Maximum
penalty—20 penalty units.(3)The driver of a
bus must not drive past a no buses sign thathas no
information on or with it indicating a mass or length.Maximum penalty—20 penalty units.Example—No
buses sign107Buses must enter signsIf
the driver of a bus drives past a buses must enter sign, thedriver must enter the area indicated by
information on or withthe sign.Maximum
penalty—20 penalty units.Example—Page
114Buses must enter signReprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 8 Traffic
signs and road markings[s 108]108Trucks and buses low gear signs(1)If the driver of a truck or bus is
driving on a length of road towhichatrucksandbuseslowgearsignapplies,thedrivermust drive the
truck or bus in a gear that is low enough tolimit the speed
of the truck or bus without the use of a primarybrake.Maximum
penalty—20 penalty units.(2)Subsection(1)doesnotapplytothedriverofabusifinformation on or with the sign indicates
that it applies only totrucks.(3)Atrucksandbuseslowgearsignonaroadappliestothelength of road beginning at the sign
and ending—(a)ifinformationonorwiththesignindicatesadistance—at that distance on the road
from the sign; or(b)in any other case—at an end trucks and
buses low gearsign on the road.(4)In
this section—primary brakemeans the
footbrake, or other brake, fitted to atruck or bus
that is normally used to slow or stop the vehicle.Examples—Trucks
and buses low gear signEnd trucks and buses low gear
signReprint 2C effective 30 November 2012Page
115
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 9 Roundabouts[s 109]Part
9Roundabouts109What
is aroundaboutAroundaboutis an
intersection—(a)with either—(i)1 or
more marked lanes, all of which are for the useof vehicles
travelling in the same direction arounda central
traffic island; or(ii)room for 1 or
more lines of traffic travelling in thesame direction
around a central traffic island; and(b)with
or without a roundabout sign at each entrance.Example—Roundabout sign110Meaning ofhalfway
arounda roundaboutA driver leaves
a roundabouthalfway aroundthe
roundaboutif the driver leaves the roundabout on a
road that is straightahead, or substantially straight
ahead, from the road on whichthe driver
enters the roundabout.111Entering a
roundabout from a multi-lane road or a roadwith 2 or more
lines of traffic travelling in the samedirection(1)A driver entering a roundabout from a
multi-lane road, or aroadwithroomfor2ormorelinesoftraffic,otherthananimals,bicycles,motorbikesormotorisedwheelchairs,Page 116Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 9
Roundabouts[s 111]travelling in
the same direction as the driver, must enter theroundabout in accordance with this
section.Maximum penalty—20 penalty units.(2)Ifthedriveristoleavetheroundaboutlessthanhalfwayaround it, the driver must enter the
roundabout—(a)from the left marked lane; or(b)iftheroadisnotamulti-laneroad—asnearaspracticable to the left side of the
road.Example—Example 1Leaving a
roundabout less than halfway around it(3)Ifthedriveristoleavetheroundaboutmorethanhalfwayaround it, the driver must enter the
roundabout from—(a)the right marked lane; or(b)if the road is not a multi-lane
road—the left of, parallelto,andasnearaspracticableto,thedividinglineormedian strip of the road.Reprint 2C effective 30 November 2012Page
117
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 9 Roundabouts[s 111]Example—Example 2Leaving a
roundabout more than halfway around it(4)If
the driver is to leave the roundabout halfway around it, thedriver may enter the roundabout from—(a)any marked lane; or(b)if the road is not a multi-lane
road—any part of the roadon which vehicles travelling in the
same direction as thedriver may travel.Page 118Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 9
Roundabouts[s 111]Example—Example 3Leaving a
roundabout halfway around it(5)Despitesubsections(2)to(4),ifthedriverisenteringtheroundaboutfromamarkedlaneandtherearetrafficlanearrows applying to the lane, the driver
must—(a)ifthearrowsindicateasingledirection—driveinthatdirection after
entering the roundabout; or(b)if
the arrows indicate 2 or more directions—drive in 1 ofthose directions after entering the
roundabout.Reprint 2C effective 30 November 2012Page
119
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 9 Roundabouts[s 111]Examples—Example 4Roundabout with 3
entry pointsExample 5Roundabout with 5
entry points(6)Subsection(3)doesnotapplytotheriderofabicycleoranimal.(7)Subsection (5) does not apply to the rider
of a bicycle or ananimaliftherideristoleavetheroundaboutmorethanhalfway around
it.(8)Despite subsection (2), a driver may
approach and enter theroundabout from the marked lane next
to the left lane as wellas, or instead of, the left lane
if—(a)the driver’s vehicle, together with
any load or projection,is at least 7.5m long; and(b)thevehicledisplaysadonotovertaketurningvehiclesign; and(c)any
part of the vehicle is within 50m of the nearest pointof
the roundabout; and(d)it is not practicable for the driver
to leave the roundaboutless than halfway around it from
within the left lane; and(e)the driver can
safely occupy the next marked lane andcansafelyleavetheroundaboutlessthanhalfwayPage
120Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 9
Roundabouts[s 111]arounditbyoccupyingthenextmarkedlaneorbothlanes.(9)Despite subsection (3), a driver may
approach and enter theroundabout from the marked lane next
to the right lane as wellas, or instead of, the right lane
if—(a)the driver’s vehicle, together with
any load or projection,is at least 7.5m long; and(b)thevehicledisplaysadonotovertaketurningvehiclesign; and(c)any
part of the vehicle is within 50m of the nearest pointof
the roundabout; and(d)it is not practicable for the driver
to leave the roundaboutmore than halfway around it from
within the right lane;and(e)the
driver can safely occupy the next marked lane andcansafelyleavetheroundaboutmorethanhalfwayarounditbyoccupyingthenextmarkedlaneorbothlanes.(10)In this
section—left lanemeans—(a)the marked lane nearest to the far
left side of the road; or(b)ifthereisanobstruction,including,forexample,aparkedcarorroadworksinthatmarkedlane—themarkedlanenearesttothatmarkedlanethatisnotobstructed.marked
lane, for a driver, does not include a special
purposelane in which the driver is not permitted to
drive.right lanemeans—(a)the marked lane nearest to the
dividing line or medianstrip of the road; or(b)ifthereisanobstruction,including,forexample,aparkedcarorroadworksinthatmarkedlane—theReprint 2C
effective 30 November 2012Page 121
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 9 Roundabouts[s 112]markedlanenearesttothatmarkedlanethatisnotobstructed.112Giving a left change of direction signal
when entering aroundabout(1)This
section applies to a driver entering a roundabout if—(a)the driver is to leave the roundabout
at the first exit afterentering the roundabout; and(b)the exit is less than halfway around
the roundabout.(2)The driver must give a left change of
direction signal whenthe driver is entering the
roundabout.Maximum penalty—20 penalty units.(3)Thedrivermustcontinuetogivethechangeofdirectionsignal until the
driver has left the roundabout.Maximum
penalty—20 penalty units.(4)This section
does not apply to a driver if the driver’s vehicle isnot
fitted with direction indicator lights.113Giving a right change of direction signal
when entering aroundabout(1)This
section applies to a driver entering a roundabout if thedriver is to leave the roundabout more than
halfway around it.(2)The driver must give a right change of
direction signal whenthe driver is entering the
roundabout.Maximum penalty—20 penalty units.(3)Thedrivermustcontinuetogivethechangeofdirectionsignal while the
driver is driving in the roundabout, unless—(a)the
driver is changing marked lanes, or entering anotherline
of traffic; or(b)the driver’s vehicle is not fitted
with direction indicatorlights.Maximum
penalty—20 penalty units.Page 122Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 9
Roundabouts[s 114]114Giving way when entering or driving in a
roundabout(1)A driver entering a roundabout must
give way to—(a)any vehicle in the roundabout;
and(b)a tram that is entering or approaching
the roundabout.Maximum penalty—20 penalty units.(2)A driver driving in a roundabout must
give way to a tram thatis in, entering or approaching the
roundabout.Maximum penalty—20 penalty units.(3)In this section—tramincludes a bus travelling along tram
tracks.115Driving in a roundabout to the left of
the central trafficisland(1)A
driver driving in a roundabout must drive—(a)to
the left of the central traffic island in the roundabout;or(b)if subsection
(2) applies to the driver—on the edge ofthe central
traffic island, to the left of the centre of theisland; or(c)if
subsection (3) applies to the driver—over the centraltraffic island, to the left of the centre of
the island.Maximum penalty—20 penalty units.(2)This subsection applies to a driver
if—(a)thedriver’svehicleistoolargetodriveintheroundaboutwithoutdrivingontheedgeofthecentraltraffic island;
and(b)thedrivercansafelydriveontheedgeofthecentraltraffic island.(3)This
subsection applies to a driver if—Reprint 2C
effective 30 November 2012Page 123
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 9 Roundabouts[s 116](a)thedriver’svehicleistoolargetodriveintheroundaboutwithoutdrivingoverthecentraltrafficisland; and(b)the
central traffic island is designed to allow a vehicle ofthat
kind to be driven over it.116Obeying traffic
lane arrows when driving in or leaving aroundaboutIfadriverisdrivinginamarkedlaneinaroundaboutandthere are traffic lane arrows applying to
the lane, the drivermust—(a)ifthearrowsindicateasingledirection—driveinorleave the roundabout in that
direction; or(b)if the arrows indicate 2 or more
directions—drive in orleave the roundabout in 1 of those
directions.Maximum penalty—20 penalty units.117Giving a change of direction signal
when changingmarked lanes or lines of traffic in a
roundabout(1)A driver driving in a roundabout must
give a left change ofdirection signal before the driver
changes marked lanes to theleft, or enters
a part of the roundabout where there is room foranother line of traffic to the left, in the
roundabout, unless thedriver’s vehicle is not fitted with
direction indicator lights.Maximum
penalty—20 penalty units.(2)A driver driving
in a roundabout must give a right change ofdirection signal
before the driver changes marked lanes to theright, or enters
a part of the roundabout where there is roomfor another line
of traffic to the right, in the roundabout.Maximum
penalty—20 penalty units.Page 124Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 10 Level
crossings[s 118]118Giving a left change of direction signal
when leaving aroundabout(1)If
practicable, a driver driving in a roundabout must give a
leftchange of direction signal when leaving the
roundabout.Maximum penalty—20 penalty units.(2)The driver must stop giving the change
of direction signal assoon as the driver has left the
roundabout.Maximum penalty—20 penalty units.(3)This section does not apply to a
driver if the driver’s vehicle isnot fitted with
direction indicator lights.119Giving way by the
rider of a bicycle or animal to a vehicleleaving a
roundaboutThe rider of a bicycle or animal who is
riding in the far leftmarked lane of a roundabout with 2 or
more marked lanes, orthe far left line of traffic in a
roundabout with room for 2 ormore lines of
traffic, other than animals, bicycles, motorbikesormotorisedwheelchairs,mustgivewaytoanyvehicleleaving the roundabout.Maximum
penalty—20 penalty units.Part 10Level
crossings120What is alevel
crossing(1)Alevel
crossingis—(a)an area where a
road and a railway meet at substantiallythe same level,
whether or not there is a level crossingsign on the road
at all or any of the entrances to the area;orReprint 2C effective 30 November 2012Page
125
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 10 Level crossings[s
121](b)anareawherearoadandtramtracksmeetatsubstantially the same level and that has a
level crossingsign on the road at each entrance to the
area.(2)In this section—roaddoes
not include a road-related area.Examples of
level crossing signs—121Stopping and
giving way at a stop sign at a level crossingA driver at a
level crossing with a stop sign must—(a)stop
as near as practicable to, but before reaching, thestop
line or, if there is no stop line, as near as practicableto,
but before reaching, the stop sign; and(b)givewaytoanytrainortramon,approachingorentering the crossing.Maximum
penalty—20 penalty units.Example—Page
126Stop signReprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 10 Level
crossings[s 122]122Giving way at a give way sign or give way
line at a levelcrossingA driver at a
level crossing with a give way sign or give waylinemustgivewaytoanytrainortramon,approachingorentering the crossing.Maximum
penalty—20 penalty units.Example—Give
way sign123Entering a level crossing when a train
or tram isapproaching etc.A driver must
not enter a level crossing if—(a)warning lights (for example, twin red lights
or rotatingred lights) are operating or warning bells
are ringing; or(b)agate,boomorbarrieratthecrossingisclosedorisopening or closing; or(c)a train or tram is on or entering the
crossing; or(d)atrainortramapproachingthecrossingcanbeseenfrom the
crossing, or is sounding a warning, and therewould be a
danger of a collision with the train or tram ifthe driver
entered the crossing; or(e)the driver can
not drive through the crossing because thecrossing, or a
road beyond the crossing, is blocked.Maximum
penalty—20 penalty units.Reprint 2C effective 30 November
2012Page 127
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 124]Example for
paragraph (e)—The crossing, or a road beyond the
crossing, may be blocked bycongestedtraffic,adisabledvehicle,acollisionbetweenvehicles or between a vehicle and a
pedestrian, or by stock onthe road.124Leaving a level crossingAdriverwhoentersalevelcrossingmustleavethelevelcrossing as soon
as the driver can do so safely.Maximum
penalty—20 penalty units.Part 11Keeping left,
overtaking andother driving rulesDivision 1General125Unreasonably obstructing drivers or
pedestrians(1)A driver must not unreasonably
obstruct the path of anotherdriver or a
pedestrian.Maximum penalty—20 penalty units.(2)For this section, a driver does not
unreasonably obstruct thepath of another driver or a pedestrian
only because—(a)the driver is stopped in traffic;
or(b)thedriverisdrivingmoreslowlythanothervehicles(unlessthedriverisdrivingabnormallyslowlyinthecircumstances).Example of a
driver driving abnormally slowly—a
driver driving at a speed of 20km/h on a length of road towhich
a speed limit of 80km/h applies when there is no reasonfor
the driver to drive at that speed on the length of roadPage
128Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 126]126Keeping a safe distance behind
vehiclesAdrivermustdriveasufficientdistancebehindavehicletravelling in
front of the driver so the driver can, if necessary,stop
safely to avoid a collision with the vehicle.Maximum
penalty—20 penalty units.127Keeping a minimum
distance between long vehicles(1)The
driver of a long vehicle must drive at least the requiredminimum distance behind another long vehicle
travelling infront of the driver, unless the driver
is—(a)driving on—(i)a
multi-lane road; or(ii)a length of road
in a built-up area; or(b)overtaking.Maximum
penalty—20 penalty units.(2)In this
section—long vehiclemeans a vehicle
that, together with any load orprojection, is
7.5m long, or longer.required minimum distancemeans—(a)for
a long vehicle in a road train area—200m; or(b)for
a long vehicle in another area—60m.roadtrainareameansanareawhereroadtrainsmaybedrivenunderapermitorguidelineundertheTransportOperations (Road
Use Management—Mass, Dimensions andLoading)
Regulation 2005.128Entering blocked
intersectionsA driver must not enter an intersection if
the driver can notdrivethroughtheintersectionbecausetheintersection,oraroad beyond the intersection, is
blocked.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
129
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 128A]Example—The intersection, or a road beyond the
intersection, may be blocked bycongested
traffic, a disabled vehicle, a collision between vehicles orbetween a vehicle and a pedestrian, or by a
fallen load on the road.128AEntering blocked
crossingAdrivermustnotenterachildren’scrossing,markedfootcrossingorpedestriancrossingifthedrivercannotdrivethrough the crossing because the crossing,
or a road beyondthe crossing, is blocked.Maximum penalty—20 penalty units.Example—Thecrossing,oraroadbeyondthecrossing,maybeblockedbycongested traffic, a disabled vehicle, a
collision between vehicles orbetween a vehicle
and a pedestrian, or a fallen load on the road.Division 2Keeping to the left129Keeping to the far left side of a
road(1)A driver on a road, other than a
multi-lane road, must drive asnear as
practicable to the far left side of the road.Maximum
penalty—20 penalty units.(2)This section
does not apply to the rider of a motorbike.(3)In
this section—roaddoes not include
a road-related area.130Keeping to the left on a multi-lane
road(1)This section applies to a driver
driving on a multi-lane roadif—(a)the speed limit applying to the driver
for the length ofroad where the driver is driving is over
80km/h; orPage 130Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 130](b)a keep left unless overtaking sign
applies to the length ofroad where the driver is
driving.(2)The driver must not drive in the right
lane unless—(a)the driver is—(i)turning right or making a U-turn from the
centre ofthe road; and(ii)giving a right change of direction signal;
or(b)the driver is overtaking; or(c)a left lane must turn left sign or
left traffic lane arrowsapply to any other lane and the driver
is not turning left;or(d)thedriverisrequiredtodriveintherightlaneundersection 159;
or(e)the driver is avoiding an obstruction;
or(f)the traffic in each other lane is
congested; or(g)the traffic in every lane is
congested; or(h)therightlaneisaspecialpurposelaneinwhichthedriver,underanotherprovisionofthisregulation,ispermitted to drive; or(i)there are only 2 marked lanes and the left
lane is a slowvehicle turn out lane.Maximum
penalty—20 penalty units.(3)A keep left
unless overtaking sign on a multi-lane road appliesto
the length of road beginning at the sign and ending at thenearest of the following—(a)an end keep left unless overtaking
sign on the road;(b)a traffic sign or road marking on the
road that indicatesthat the road is no longer a multi-lane
road;(c)if the road ends at a T-intersection
or dead end—the endof the road.(4)In
this section—Reprint 2C effective 30 November 2012Page
131
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 131]lane,
for a driver, means a marked lane for vehicles travellinginthesamedirectionasthedriver,butdoesnotincludeaspecial purpose lane in which the driver is
not permitted todrive.slow vehicle
turn out lanemeans a marked lane, or the part ofamarkedlane,towhichaslowvehicleturnoutlanesignapplies.Note—A slow vehicle turn out lane is
designed for slow-moving vehicles tomove into to
allow faster vehicles to pass in an adjacent marked lane.Examples—Keep
left unless overtaking signEnd keep left unless overtaking
signSlow vehicle turn out lane sign131Keeping to the left of oncoming
vehicles(1)Adrivermustdrivetotheleftofanyoncomingvehicleunless—(a)the driver is turning right at an
intersection; and(b)the driver is passing an oncoming
vehicle turning rightat the intersection; andPage
132Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 131](c)there is no traffic sign or road
marking indicating thatthe driver must pass to the left of
the oncoming vehicle.Maximum penalty—20 penalty
units.(2)This section does not apply to the
rider of a motorbike that is apostal vehicle,
the rider of a bicycle or the rider of an animalif—(a)the rider is
riding on a footpath, nature strip or sharedpath; and(b)the rider is permitted to ride on the
footpath, nature stripor shared path under this regulation;
and(c)either—(i)the
oncoming vehicle is not on the footpath, naturestrip or shared
path; or(ii)the oncoming
vehicle is not permitted, under thisregulation,tobeonthefootpath,naturestriporshared path.Examples—Example 1Example 2Driving to the left of an oncoming
vehicleOncoming vehicles turning right
passingto the right of each otherReprint 2C effective 30 November 2012Page
133
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 132]132Keeping to the left of the centre of a road
or the dividingline(1)A
driver on a two-way road without a dividing line or medianstrip must drive to the left of the centre
of the road, except aspermitted under section 133 or
139(1).Maximum penalty—20 penalty units.(2)A driver on a road with a dividing
line (except 2 continuousdividinglines)mustdrivetotheleftofthedividingline,except as
permitted under section 134 or 139(2).Maximum
penalty—20 penalty units.(2A)A driver on a
road with a single continuous dividing line, asingle
continuous dividing line to the left of a broken dividinglineor2parallelcontinuousdividinglinesmustnotdriveacross the
dividing lines to perform a U-turn.Maximum
penalty—20 penalty units.(3)A driver on a
road with 2 continuous dividing lines must drivetotheleftofthedividinglines,exceptaspermittedundersection 139(2).Maximum
penalty—20 penalty units.(4)This section,
and sections 133, 134 and 139(1) and (2), applyto a service
road to which a two-way sign applies as if it werea
separate road, but do not apply to any other service road.(5)In this section—roaddoes
not include a footpath, nature strip, bicycle path,separated footpath or shared path.Page
134Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 132]Example of two-way sign—Two-way signExamples for
subsection (2)—Example 1Driving to the
left of a single continuousdividing line onlyExample 2Driving to the left of a single
continuousdividing line to the left of a brokendividing lineReprint 2C
effective 30 November 2012Page 135
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 133]Example 3Driving to the left of 2 parallel continuous
dividing lines133Exceptions to keeping to the left of
the centre of a road(1)This section
applies to a driver on a two-way road without adividing line or
median strip.(2)The driver may drive to the right of
the centre of the road—(a)to overtake
another driver; or(b)to enter or leave the road; or(c)to enter a part of the road of 1 kind
from a part of theroad of another kind (for example, moving to
or from aservice road or emergency stopping
lane).(3)The driver may also drive to the right
of the centre of the roadif—(a)because of the width or condition of the
road, it is notpracticable to drive to the left of the
centre of the road;and(b)the driver can
do so safely.Page 136Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 134]134Exceptions to keeping to the left of a
dividing line(1)This section applies to a driver on a
road with a dividing line.(2)If the dividing
line is a broken dividing line only, or a brokendividing line to the left of a single
continuous dividing line,the driver may drive to the right of
the dividing line—(a)to overtake another driver; or(b)to perform a U-turn, unless the driver
is prohibited fromperformingtheU-turnunderanotherprovisionofthisregulation.(3)If
the dividing line is not 2 parallel continuous dividing
lines,the driver may drive to the right of the
dividing line—(a)to enter or leave the road; or(b)to enter a part of the road of 1 kind
from a part of theroad of another kind (for example, moving to
or from aservice road or emergency stopping
lane).Examples—Example 1Driving to the
right of the centre of theroad permitted—overtaking on a
roadwith a broken dividing line onlyExample 2Driving to the
right of the centre of theroad permitted—overtaking on a
roadwith a broken dividing line to the left of
asingle continuous dividing lineReprint 2C effective 30 November 2012Page
137
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 135]Example 3Driving to the right of the centre of
theroad not permitted—overtaking on aroad
with a single continuous dividingline onlyExample 4Driving to the
right of the centre of theroad not permitted—overtaking on a
roadwith a single continuous dividing line
tothe left of a broken dividing lineExample 5Driving to the
right of the centre of the road not permitted—overtaking on a
roadwith 2 parallel continuous dividing
lines135Keeping to the left of a median
strip(1)A driver on a road with a median strip
must drive to the left ofthe median strip, unless the driver
is—(a)entering or driving in a median strip
parking area; orPage 138Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 136](b)required to drive to the right of the
median strip by akeep right sign.Maximum
penalty—20 penalty units.(2)In this
section—median stripdoes not include
a painted island.Example—Keep
right sign136Driving on a one-way service
roadA driver on the part of the road that is a
service road (except aservice road to which a two-way sign
applies) must drive inthe same direction as a vehicle
travelling on the part of theroad closest to
the service road must travel.Maximum
penalty—20 penalty units.Example—Two-way signReprint 2C
effective 30 November 2012Page 139
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 137]137Keeping off a dividing strip(1)Adrivermustnotdriveonadividingstrip,exceptaspermitted under this section or section
139(4).Maximum penalty—20 penalty units.(2)A driver may drive on a dividing strip
that is at the same levelas the road, and marked at each side
by a continuous line—(a)to enter or
leave the road; or(b)to enter or leave an area on the
dividing strip to which aparking control sign applies if the
driver is permitted topark in the area.(3)In
this section—dividing stripdoes not include
a painted island.138Keeping off a painted island(1)A driver must not drive on or over a
single continuous line, or2 parallel continuous lines, along a
side of or surrounding apaintedisland,exceptaspermittedunderthissectionorsection 139(4).Maximum
penalty—20 penalty units.Page 140Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 138]Example—Painted island surrounded by 2 parallel
continuous linesIn this example, vehicle B is contravening
the section.(2)A driver may drive on or over a single
continuous line alongthe side of or surrounding a painted
island for up to 50m—(a)to enter or
leave the road; or(b)to enter a turning lane that begins
immediately after thepainted island.(3)Subsection(2)(a)doesnotapplyinthecaseofapaintedisland—(a)that separates a road that takes
vehicles in 1 directionfromanotherroadthattakesvehiclesinthesamedirection at a place where the roads merge;
or(b)that separates 1 part of a road from
other parts of theroad to create a slip lane.Reprint 2C effective 30 November 2012Page
141
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 139]Examples—Example 1Painted island
separating traffic flow inthe same directionExample 2Painted island separating traffic flow
inthe same directionIn examples 1 and
2, vehicle B is contravening the section.139Exceptions for avoiding obstructions on a
road(1)A driver on a two-way road without a
dividing line or medianstrip may drive to the right of the
centre of the road to avoidan obstruction
if—(a)the driver has a clear view of any
approaching traffic;and(b)it
is necessary and reasonable, in all the circumstances,for
the driver to drive to the right of the centre of theroad
to avoid the obstruction; and(c)the
driver can do so safely.(2)A driver on a
road with a dividing line may drive to the rightof
the dividing line to avoid an obstruction if—(a)the
driver has a clear view of any approaching traffic;and(b)it is necessary
and reasonable, in all the circumstances,for the driver
to drive to the right of the dividing line toavoid the
obstruction; andPage 142Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 140](c)the driver can do so safely.(3)For subsection (2), if the dividing
line is a single continuousdividinglinetotheleftofabrokendividingline,asinglecontinuousdividinglineonlyor2parallelcontinuousdividing lines,
the hazard in driving to the right of the dividinglinemustbetakenintoaccountindecidingwhetheritisreasonable to
drive to the right of the dividing line.(4)A
driver may drive on a dividing strip, or on or over a singlecontinuous line, or 2 parallel continuous
lines, along a side ofor surrounding a painted island, to
avoid an obstruction if—(a)the driver has a
clear view of any approaching traffic;and(b)it is necessary and reasonable to
drive on the dividingstrip or painted island to avoid the
obstruction; and(c)the driver can do so safely.Division 3Overtaking140No
overtaking unless safe to do soA driver must
not overtake a vehicle unless—(a)the
driver has a clear view of any approaching traffic;and(b)the driver can
safely overtake the vehicle.Maximum
penalty—20 penalty units.141No overtaking
etc. to the left of a vehicle(1)A
driver (except the rider of a bicycle) must not overtake avehicle to the left of the vehicle
unless—(a)the driver is driving on a multi-lane
road and the vehiclecan be safely overtaken in a marked
lane to the left ofthe vehicle; orReprint 2C
effective 30 November 2012Page 143
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 142](b)the
vehicle is turning right, or making a U-turn from thecentreoftheroad,andisgivingarightchangeofdirection signal and it is safe to
overtake to the left of thevehicle;
or(c)the vehicle is stationary and can be
safely overtaken tothe left of the vehicle.Maximum
penalty—20 penalty units.(2)The rider of a
bicycle must not ride past, or overtake, to theleft of a
vehicle that is turning left and is giving a left changeof
direction signal.Maximum penalty—20 penalty units.(3)In this section—turning
rightdoes not include making a hook turn.vehicledoes not include
a tram, a bus travelling along tramtracks,oranyvehicledisplayingadonotovertaketurningvehicle
sign.142No overtaking to the right of a
vehicle turning right etc.(1)Adrivermustnotovertaketotherightofavehicleifthevehicle is—(a)turning right or making a U-turn from the
centre of theroad; and(b)giving a right change of direction
signal.Maximum penalty—20 penalty units.(2)In this section—turning
rightdoes not include making a hook turn.vehicledoes not include
a tram, a bus travelling along tramtracks,oranyvehicledisplayingadonotovertaketurningvehicle
sign.Page 144Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 143]143Passing or overtaking a vehicle
displaying a do notovertake turning vehicle sign(1)Adrivermustnotdrivepast,orovertake,totheleftofavehicle displaying a do not overtake
turning vehicle sign if thevehicle is
turning left and is giving a left change of directionsignal, unless it is safe to do so.Maximum penalty—20 penalty units.(2)Adrivermustnotdrivepast,orovertake,totherightofavehicle displaying a do not overtake
turning vehicle sign if thevehicle is
turning right, or making a U-turn from the centre oftheroad,andisgivingarightchangeofdirectionsignal,unless it is safe to do so.Maximum penalty—20 penalty units.Example—Adriverdrivingonamulti-laneroadwhoisturningrightatanintersection to
which a right turn only sign applies may drive past avehicle displaying a do not overtake turning
vehicle sign that is turningright from
another marked lane, and giving a right change of directionsignal, if it is safe to do so.(3)In this section—turning
rightdoes not include making a hook turn.Examples of do not overtake turning vehicle
signs—144Keeping a safe
distance when overtakingA driver overtaking a vehicle—Reprint 2C effective 30 November 2012Page
145
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 145](a)must
pass the vehicle at a sufficient distance to avoid acollision with the vehicle or obstructing
the path of thevehicle; and(b)mustnotreturntothemarkedlaneorlineoftrafficwherethevehicleistravellinguntilthedriverisasufficient distance past the vehicle
to avoid a collisionwith the vehicle or obstructing the
path of the vehicle.Maximum penalty—20 penalty
units.145Driver being overtaken not to increase
speedIf a driver is overtaking another driver on
a two-way road bycrossing a dividing line, or crossing to the
right of the centreoftheroad,theotherdrivermustnotincreasethespeedatwhich the driver is driving until the first
driver—(a)has passed the other driver;
and(b)has returned to the marked lane or
line of traffic wherethe other driver is driving;
and(c)isasufficientdistanceinfrontoftheotherdrivertoavoid a collision.Maximum
penalty—20 penalty units.Division 4Driving in
marked lanes or lines oftraffic146Driving within a single marked lane or line
of traffic(1)Adriveronamulti-laneroadmustdrivesothedriver’svehicle is completely in a marked lane,
unless the driver is—(a)entering a part
of the road of 1 kind from a part of theroad of another
kind (for example, moving to or from aservice road or
a shoulder of the road); or(b)entering or leaving the road; or(c)moving from 1 marked lane to another
marked lane; orPage 146Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 147](d)avoiding an obstruction; or(e)obeying a traffic control device
applying to the markedlane; or(f)permitted to drive in more than 1 marked
lane under thisregulation.Maximum
penalty—20 penalty units.(2)A driver on a
road with 2 or more lines of traffic travelling inthesamedirectionasthedriver,butwithoutmarkedlanes,must drive so
the driver’s vehicle is completely in a single lineof
traffic unless—(a)it is not practicable to drive
completely in a single lineof traffic;
or(b)the driver is entering a part of the
road of 1 kind from apart of the road of another kind (for
example, moving toor from a service road or a shoulder of the
road); or(c)the driver is entering or leaving the
road; or(d)the driver is moving from 1 line of
traffic to another lineof traffic; or(e)the
driver is avoiding an obstruction.Maximum
penalty—20 penalty units.147Moving from 1
marked lane to another marked laneacross a
continuous line separating the lanes(1)A
driver on a multi-lane road must not move from 1 markedlanetoanothermarkedlanebycrossingacontinuouslineseparating the lanes unless—(a)the driver is avoiding an obstruction;
or(b)the driver is obeying a traffic
control device applying tothe first marked lane; or(c)thedriverispermittedtodriveinbothmarkedlanesunder subsection
(2); orReprint 2C effective 30 November 2012Page
147
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 148](d)either of the marked lanes is a special
purpose lane inwhichthedriverispermittedtodriveunderthisregulationandthedriverismovingtoorfromthespecial purpose lane.Maximum
penalty—20 penalty units.(2)A driver on a
multi-lane road may move from 1 marked lanetoanothermarkedlanebycrossingacontinuouslineseparating the lanes if—(a)thedrivermakesthemovetoapproachorenteranintersection from the multi-lane road and
section 28(2)or 32(2) applies to the driver for the
purpose of makingthe move; or(b)thedrivermakesthemovetoapproachorenteraroundabout from the multi-lane road and
section 111(8)or (9) applies to the driver for the purpose
of making themove.148Giving way when moving from 1 marked lane or
line oftraffic to another marked lane or line of
traffic(1)A driver who is moving from 1 marked
lane (whether or notthe lane is ending) to another marked
lane must give way toany vehicle travelling in the same
direction as the driver in themarked lane to
which the driver is moving.Maximum
penalty—20 penalty units.Page 148Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 148]Examples—Example 1In these examples,
vehicle B must give way to vehicle A.Example 2(2)A driver on a road with 2 or more
lines of traffic travelling inthe same
direction as the driver, and who is moving from 1line
of traffic to another line of traffic, must give way to anyvehicle travelling in the same direction as
the driver in the lineof traffic to which the driver is
moving.Maximum penalty—20 penalty units.(3)Subsection (2) does not apply to a
driver if the line of traffic inwhich the driver
is driving is merging with the line of trafficto which the
driver is moving.Reprint 2C effective 30 November 2012Page
149
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 148A]148AGiving way when moving within a single
marked laneIf a driver diverges to the left or right
within a marked lane,the driver must give way to any
vehicle that is in the lane.Maximum
penalty—20 penalty units.149Giving way when
lines of traffic merge into a single lineof trafficA
driver in a line of traffic that is merging with 1 or more
linesof traffic travelling in the same direction
as the driver mustgive way to a vehicle in another line of
traffic if any part of thevehicle is ahead of the driver’s
vehicle.Maximum penalty—20 penalty units.Example—Giving way when lines of traffic merge into
a single line of trafficIn this example, vehicle B must give
way to vehicle A.150Driving on or across a continuous
white edge line(1)A driver must not drive on or over a
continuous white edgeline on a road unless subsection (1A)
or (1B) applies to thedriver.Maximum
penalty—20 penalty units.Page 150Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 150](1A)A driver may
drive on or over a continuous white edge line ona
road if the driver is—(a)overtaking a
vehicle that is turning right, or making aU-turn from the
centre of the road, and is giving a rightchange of
direction signal; or(b)drivingaslow-movingvehicle,anditisnecessaryforthe
driver to drive on or over the edge line to allow thevehicle to be overtaken or passed by another
vehicle; or(c)driving a vehicle that is too wide, or
too long, to drive onthe road without driving on or over
the edge line; or(d)avoiding an obstruction.(1B)A driver may
drive on or over a continuous white edge line ona
road for up to 100m if the driver is—(a)turning at an intersection; or(b)entering or leaving the road;
or(c)entering a part of the road of 1 kind
from a part of theroad of another kind (for example, moving to
or from aserviceroad,ashoulderoftheroadoranemergencystopping lane);
or(d)stopping at the side of the road
(including any shoulderof the road).(2)This
section does not apply to the rider of a bicycle or animal.(3)For this section, a driver drives over
a continuous white edgeline on a road if—(a)for
a line on the far left side of the road—the driver’svehicle is completely or partly to the left
of the line; or(b)for a line on the far right side of
the road—the driver’svehicle is completely or partly to the
right of the line.Reprint 2C effective 30 November 2012Page
151
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 151]151Riding a motorbike or bicycle alongside more
than 1other rider(1)The
rider of a motorbike or bicycle must not ride on a roadthat
is not a multi-lane road alongside more than 1 other rider,unless subsection (3) applies to the
rider.Maximum penalty—20 penalty units.(2)The rider of a motorbike or bicycle
must not ride in a markedlanealongsidemorethan1otherriderinthemarkedlane,unless
subsection (3) applies to the rider.Maximum
penalty—20 penalty units.(3)The rider of a
motorbike or bicycle may ride alongside morethan 1 other
rider if the rider is overtaking the other riders.(4)If the rider of a motorbike or bicycle
is riding on a road that isnot a multi-lane
road alongside another rider, or in a markedlane alongside
another rider in the marked lane, the rider mustride
not over 1.5m from the other rider.Maximum
penalty—20 penalty units.(5)In this
section—roaddoesnotincludearoad-relatedarea,butincludesabicycle path, a shared path and any shoulder
of the road.Division 5Obeying overhead
lane controldevices applying to marked lanes152Complying with overhead lane control
devices(1)A driver in a marked lane to which an
overhead lane controldevice applies must comply with this
section.Maximum penalty—20 penalty units.(2)If the device displays an illuminated
red diagonal cross or is atrafficsigndisplayingared
diagonalcross,thedrivermustnot
drive in the marked lane past the device.Page 152Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 152](3)Ifthedevicedisplaysaflashingilluminatedreddiagonalcross, the
driver must leave the marked lane as soon as it issafe
to do so.(4)If the device displays an illuminated
white, green or yellowarrow pointing downwards or indicating
1 or more directions,the driver may drive in the marked
lane past the device.Example—Overhead lane control device applying to
marked lanes(5)Also,ifthedevicedisplaysaspeedlimitsign(variableilluminated message sign), the driver may
drive in the markedlane past the device.Note—See also section 20.(6)A lane control ends sign on a road has
the effect that once thedriver has passed the sign, the
overhead lane control deviceforwhichthesignisdisplayednolongerregulateswhichmarked lanes the
driver may or must drive in or must leave.Reprint 2C
effective 30 November 2012Page 153
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 153]Example—Lane control ends signDivision 6Driving in
marked lanes designatedfor special purposes153Bicycle lanes(1)A
driver(except the rider of a bicycle) must not
drive in abicyclelane,unlessthedriverispermittedtodriveinthebicycle lane under this section or
section 158.Maximum penalty—20 penalty units.(2)If stopping or parking is permitted at
a place in a bicycle laneunder this regulation, a driver may
drive for up to 50m in thebicycle lane to stop or park at that
place.(3)A driver may drive for up to 50m in a
bicycle lane if the driveris—(a)driving a bus or taxi; and(b)dropping off, or picking up,
passengers.(4)Abicyclelaneisamarkedlane,orthepartofamarkedlane—(a)beginning at a bicycle lane sign applying to
the lane; and(b)ending at the nearest of the
following—Page 154Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 154](i)an end bicycle lane sign applying to
the lane;(ii)an intersection
(unless the lane is at the unbrokensideofthecontinuingroadataT-intersectionorcontinued across the intersection by broken
lines);(iii)if the road ends
at a dead end—the end of the road.Examples—Bicycle lane signEnd bicycle lane
sign154Bus lanes(1)A
driver must not drive in a bus lane, unless the driver is—(a)driving—(i)a
bus; or(ii)a bicycle or
taxi; or(b)permitted to drive in the bus lane
under section 158.Maximum penalty—20 penalty units.(2)Abus laneis a
marked lane, or the part of a marked lane—(a)beginning at a bus lane sign (whether or not
there is alsoa bus lane road marking) and ending at the
nearest of thefollowing—(i)an
end bus lane sign;(ii)a traffic sign
that indicates the beginning of anotherspecial purpose
lane; orReprint 2C effective 30 November 2012Page
155
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 155](b)beginning at a bus lane road marking (if
there is no buslane sign) and ending at the next
intersection.(3)In this section—bus lane road
markingmeans a road marking consisting of—(a)the letters ‘BL’; or(b)the words ‘bus lane’; or(c)the words ‘bus only’.Examples—Bus
lane signEnd bus lane sign155Tram
lanes(1)A driver must not drive in a tram
lane, unless the driver is—(a)driving—(i)a
tram, tram recovery vehicle or bus; or(ii)a
bicycle, bus or taxi; or(b)permitted to
drive in the tram lane under this section orsection
158.Maximum penalty—20 penalty units.(2)A driver may drive in a tram lane if
the driver is driving atruck and it is necessary for the
driver to drive in the tram laneto reach a place
to drop off, or pick up, passengers or goods.(3)Atram laneis a part of a
road with tram tracks that—Page 156Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 155A](a)is between a tram lane sign and an end
tram lane sign;and(b)is marked along
the left side of the tracks (when facingthedirectionoftravelofatramonthetracks)byacontinuous yellow line parallel to the
tracks.Examples—Tram
lane signEnd tram lane signTram lane155ATramways(1)A
driver (except the driver of a tram, tram recovery vehicle
orbus)mustnotdriveinatramway,unlessthedriverispermitted to drive in the tramway under
subsection (2).Maximum penalty—20 penalty units.(2)A driver may drive in a tramway
if—Reprint 2C effective 30 November 2012Page
157
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 155A](a)it
is necessary for the driver to drive in the tramway toavoid an obstruction; and(b)when driving in the tramway, the
driver does not moveinto the path of an approaching tram
or bus travelling inthe tramway.(3)Atramwayis a part of a
road with tram tracks that—(a)isbetweenatramwaysignandanendtramwaysign;and(b)is marked along
the left side of the tracks (when facingthedirectionoftravelofatramonthetracks)byeither—(i)2
continuous yellow lines parallel to the tracks; or(ii)astructure(forexample,adividingstrip,pedestrian refuge, traffic island, row of
bollards orseparationkerb),whetherornotthestructureisalso being used to indicate a safety
zone;butdoesincludeanypartoftheroadwherevehiclesarepermitted to cross the tramway.(4)Forthepurposesofsubsection(3)(b)(i),alineistobeconsideredtobecontinuousdespiteanybreakinitthatisdesigned to permit vehicles to cross the
tramway.Examples—Tramway signPage 158End
tramway signReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 156]Tramway with double yellow lineTramway with separation kerb156Transit lanes(1)A
driver must not drive in a transit lane, unless—(a)the driver is driving—(i)a bicycle, bus, motorbike, taxi or
tram; or(ii)if the transit
lane sign applying to the transit lane isa transit lane
(T2) sign—a vehicle carrying at least1 other person;
or(iii)if the transit
lane sign applying to the transit lane isa transit lane
(T3) sign—a vehicle carrying at least2 other people;
or(b)the driver is permitted to drive in
the transit lane undersection 158.Maximum
penalty—20 penalty units.(2)Atransit laneis a marked
lane, or the part of a marked lane—(a)beginning at a transit lane sign; and(b)ending at an end transit lane
sign.Reprint 2C effective 30 November 2012Page
159
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 157]Examples of
transit lane signs—Transit lane (T2) signExamples of end transit lane signs—Transit lane (T3) signEnd
transit lane (T2) signEnd transit lane (T3) sign157Truck lanes(1)A
driver must not drive in a truck lane, unless—(a)the
driver is driving a truck; or(b)the
driver is permitted to drive in the truck lane undersection 158.Maximum
penalty—20 penalty units.(2)Atruck laneis a marked
lane, or the part of a marked lane—(a)beginning at a truck lane sign; and(b)ending at an end truck lane
sign.Page 160Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 158]Examples—Truck
lane signEnd truck lane sign158Exceptions to driving in special purpose
lanes etc.(1)The driver of any vehicle may drive
for up to the permitteddistance in a bicycle lane, bus lane,
tram lane, transit lane ortruck lane if it is necessary for the
driver to drive in the lane—(a)to
enter or leave the road; or(b)to
enter a part of the road of 1 kind from a part of theroad
of another kind (for example, moving to or from aservice road, the shoulder of the road or an
emergencystopping lane); or(c)to
overtake a vehicle that is—(i)turning right, or making a U-turn from the
centreof the road; and(ii)giving a right change of direction signal;
or(d)to enter a marked lane, or a part of
the road where thereis room for a line of traffic, other
than animals, bicycles,motorbikes or motorised wheelchairs,
from the side ofthe road.(2)Thedriverofanyvehiclemaydriveinabicyclelane,buslane, tram lane, transit lane or truck
lane if—(a)it is necessary for the driver to
drive in the lane to avoidan obstruction; orReprint 2C
effective 30 November 2012Page 161
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 159](b)information on or with a traffic sign
applying to the laneindicates that the driver may drive in
the lane.(3)It is a defence to the prosecution of
a driver for an offenceagainstaprovisionofthisdivisionfordrivinginabicyclelane, bus lane,
tram lane, transit lane or truck lane if—(a)it
is necessary for the driver to drive in the lane to stop ata
place in the lane; and(b)either—(i)the driver is permitted to stop at
that place underthis regulation; or(ii)it
is a defence under section 165 for the driver tostop
at that place; and(c)if the lane is a bicycle lane—the
driver drives in the lanefor no more than the permitted
distance.(4)In this section—permitted
distancemeans—(a)for
a bicycle lane or a tram lane—50m; or(b)for
any other lane—100m.159Marked lanes required to be used by
particular kinds ofvehicles(1)If
information on or with a traffic sign applying to a length
ofroad indicates that a vehicle of a
particular kind must drive inaparticularmarkedlane,adriverdrivingavehicleofthatkind on the
length of road must drive in the indicated lane,unless the driver is—(a)avoiding an obstruction; or(b)obeying a traffic control device
applying to the indicatedlane; or(c)permitted to drive in the indicated lane and
also anothermarked lane under this regulation.Maximum penalty—20 penalty units.Page
162Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 160](2)Atrafficsignmentionedinthissectionthatisonaroadapplies to the length of road beginning at
the sign and endingat the nearest of the following—(a)a traffic sign or road marking on the
road that indicatesthat the first traffic sign no longer
applies;(b)the next intersection on the
road;(c)if the road ends at a T-intersection
or dead end—the endof the road.Examplesofatrafficsignmentionedinthesectionandatrafficsignindicating that
the first traffic sign no longer applies—Trucks
use left lane signEnd trucks use left lane signDivision 7Passing trams
and safety zones160Passing or overtaking a tram that is
not at or near the leftside of the road(1)This
section applies to a driver driving on a road with tramtracks that are not at or near the far left
side of the road.(2)The driver must not drive past, or
overtake, a tram to the rightof the tram,
unless a traffic sign or a road marking indicatesthat
the driver may drive past, or overtake, the tram to the
rightof the tram.Maximum
penalty—20 penalty units.(3)The driver must
not drive past, or overtake, a tram if the tramis turning left
or is giving a left change of direction signal,unless—Reprint 2C effective 30 November 2012Page
163
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 161](a)the
driver is turning left; and(b)there is no danger of a collision with the
tram.Maximum penalty—20 penalty units.(4)In this section—tramincludes a bus travelling along tram
tracks.161Passing or overtaking a tram at or
near the left side of aroad(1)This
section applies to a driver driving on a road with tramtracks at or near the far left side of the
road.(2)The driver must not drive past, or
overtake, a tram to the leftofthetramunlessthedriveristurningleftandthereisnodanger of a collision with the
tram.Maximum penalty—20 penalty units.(3)The driver must not drive past, or
overtake, a tram if the tramis turning right
or is giving a right change of direction signal.Maximum penalty—20 penalty units.(4)In this section—tramincludes a bus travelling along tram
tracks.162Driving past a safety zone(1)A driver driving past a safety
zone—(a)must not drive on the safety zone;
and(b)must drive to the left of the safety
zone at a speed thatdoes not put at risk the safety of any
pedestrian crossingthe road to or from the safety zone.Maximum penalty—20 penalty units.(2)Asafety
zoneis an area of a road—(a)at a
place with safety zone signs at or near a tram stop;andPage 164Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 11 Keeping
left, overtaking and other driving rules[s 163](b)indicatedbyastructureontheroad(forexample,adividing strip, pedestrian refuge or traffic
island).Example—Safety zone sign163Driving past the rear of a stopped tram at a
tram stop(1)This section applies if—(a)a driver is driving behind the rear of
a tram travelling inthe same direction as the driver;
and(b)the tram stops at a tram stop, other
than a tram stop atthe far left side of the road; and(c)thereisnosafetyzone,dividingstriportrafficislandbetweenthetramandthepartoftheroadwherethedriver is driving.(2)The
driver must stop before passing the rear of the tram.Maximum penalty—20 penalty units.(3)After stopping under subsection (2),
the driver must not drivepast the tram if—(a)the
tram’s doors are open; or(b)a pedestrian is
entering or crossing the road between thetram tracks and
the far left side of the road.Maximum
penalty—20 penalty units.(4)Also, after
stopping under subsection (2), if the tram remainsat
the tram stop and subsection (3)(a) and (b) do not apply,
thedriver must not drive past the tram at a
speed over 10km/h.Reprint 2C effective 30 November 2012Page
165
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 11 Keeping left, overtaking and
other driving rules[s 164]Maximum
penalty—20 penalty units.(5)Subsections (2)
to (4) do not apply to a driver if the driver isdirected to drive past the tram by an
authorised officer.(6)In this section—tramincludes a bus travelling along tram
tracks.164Stopping beside a stopped tram at a
tram stop(1)This section applies if—(a)adriverisdrivingalongside,orovertaking,atramtravelling in
the same direction as the driver; and(b)the
tram stops at a tram stop, other than a tram stop atthe
far left side of the road; and(c)thereisnosafetyzone,dividingstriportrafficislandbetweenthetramandthepartoftheroadwherethedriver is driving.(2)The
driver must stop when the tram stops.Maximum
penalty—20 penalty units.(3)After stopping
under subsection (2), the driver must not drivepast, or
overtake, the tram if—(a)the tram’s doors
are open; or(b)a pedestrian is entering or crossing
the road between thetram tracks and the far left side of
the road.Maximum penalty—20 penalty units.(4)Also, after stopping under subsection
(2), if the tram remainsat the tram stop and subsection (3)(a)
and (b) do not apply, thedrivermustnotdrivepast,orovertake,thetramataspeedover
10km/h.Maximum penalty—20 penalty units.(5)Subsections (2) to (4) do not apply to
a driver if the driver isdirected to drive past the tram by an
authorised officer.Page 166Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 164A](6)In this section—tramincludes a bus travelling along tram
tracks.Part 12Restrictions on
stopping andparkingDivision 1General164AMinor
traffic offencesFor section 108 of the Act,
definitionminor traffic offence, theoffences in this part are prescribed.165Stopping in an emergency etc. or to
comply with anotherprovisionIt is a defence
to the prosecution of a driver for an offenceagainst a
provision of this part if—(a)the driver stops
at a particular place, or in a particularway,toavoidacollision,andthedriverstopsfornolonger than is
necessary to avoid the collision; or(b)the
driver stops at a particular place, or in a particularway,becausethedriver’svehicleisdisabled,andthedriverstopsfornolongerthanisnecessaryforthevehicle to be moved safely to a place
where the driver ispermitted to park the vehicle under the Act;
or(c)the driver stops at a particular
place, or in a particularway, to deal with a medical or other
emergency, or toassistadisabledvehicle,andthedriverstopsfornolonger than is necessary in the
circumstances; or(d)the driver stops at a particular
place, or in a particularway, because the condition of the
driver, a passenger, orthe driver’s vehicle makes it
necessary for the driver toReprint 2C
effective 30 November 2012Page 167
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 166]stop in the
interests of safety, and the driver stops for nolonger than is necessary in the
circumstances; or(e)the driver stops at a particular
place, or in a particularway, to comply with this regulation,
and the driver stopsfor no longer than is necessary to
comply with the otherprovision.Example for
paragraph (e)—If a driver stops at an intersection
at a stop line, stop sign, ortraffic lights,
or to give way to a vehicle, the driver does notcontravene section 170 (Stopping in or near
an intersection).166Application of part to bicyclesThis
part does not apply to a bicycle that is parked at a bicyclerail
or in a bicycle rack.Division 2No stopping and
parking signs androad markings167No
stopping signsA driver must not stop on a length of road
or in an area towhich a no stopping sign applies.Maximum penalty—20 penalty units.Examples of no stopping signs—No stopping sign (for a length of
road)No stopping sign (for an area)Page
168Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 168]168No parking signs(1)The
driver of a vehicle must not stop on a length of road or inan
area to which a no parking sign applies, unless the driver—(a)is dropping off, or picking up,
passengers or goods; and(b)does not leave
the vehicle unattended; and(c)completesthedroppingoff,orpickingup,ofthepassengers or
goods, and drives on, as soon as possibleand, in any
case, within the required time after stopping.Maximum
penalty—20 penalty units.(2)For this
section, a driver leaves a vehicleunattendedif thedriverleavesthevehiclesothedriverisover3mfromtheclosest point of the vehicle.(3)In this section—required
timemeans—(a)if
information on or with the sign indicates a time—theindicated time; or(b)if
there is no indicated time—2 minutes; or(c)if
there is no indicated time, or the indicated time is lessthan
5 minutes, and section 206 applies to the driver—5minutes.Examples of no
parking signs—No parking sign (for a length of
road)Reprint 2C effective 30 November 2012No
parking sign (for an area)Page 169
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 169]169No
stopping on a road with a yellow edge lineA driver must
not stop at the side of a road marked with acontinuous
yellow edge line.Maximum penalty—20 penalty units.Division 3Stopping at
intersections andcrossings170Stopping in or near an intersection(1)A driver must not stop at a place in
an intersection unless—(a)thedriverispermittedtostopattheplaceunderthisregulation;
or(b)the intersection is a T-intersection
without traffic lightsandthedriverstopsalongthecontinuoussideofthecontinuing road
at the intersection.Maximum penalty—20 penalty
units.(2)A driver must not stop on a road
within 20m from the nearestpointofanintersectingroadatanintersectionwithtrafficlights, unless
the driver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(3)However, subsection (2) does not apply
if a no stopping signis installed within 20m from the
nearest point.Example—Ifanostoppingsignisinstalled6mfromthenearestpointofanintersecting road to which subsection
(2) would otherwise apply, it is notan offence
against subsection (2) for a driver to stop within 20m, butmore
than 6m, from the nearest point.Page 170Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 170](4)A driver must not stop on a road
within 10m from the nearestpoint of an
intersecting road at an intersection without trafficlights, unless—(a)the
driver—(i)stops at a place on a length of road,
or in an area, towhich a parking control sign applies;
and(ii)ispermittedtostopatthatplaceunderthisregulation; or(b)iftheintersectionisaT-intersection—thedriverstopsalong the
continuous side of the continuing road at theintersection.Maximum
penalty—20 penalty units.(5)However,
subsection (4) does not apply if a no stopping signis
installed within 10m from the nearest point.(6)For
this section, distances are measured—(a)in
the direction in which the driver is driving; and(b)as shown in—(i)for
subsection (2)—example 1; or(ii)for
subsection (4)—example 2.(7)In this
section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Reprint 2C
effective 30 November 2012Page 171
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 171]Examples—Example 1Measurement of
distance—intersectionwith traffic lightsExample 2Measurement of
distance—T-intersectionwithout traffic lights171Stopping on or near a children’s
crossing(1)A driver must not stop—(a)on a children’s crossing; or(b)on the road within 20m before the
crossing or 10m afterthe crossing.Maximum
penalty—20 penalty units.(2)For this
section, distances are measured—(a)in
the direction in which the driver is driving; and(b)as shown in example 1 or 2.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Page 172Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 172]Examples—Example 1Measurement of
distance—children’scrossing with red and white postsExample 2Measurement of
distance—children’scrossing with 2 parallel continuous
orbroken lines172Stopping on or near a pedestrian crossing
(except at anintersection)(1)A
driver must not stop on a pedestrian crossing that is not atan
intersection, or on the road within 20m before the crossingand
10m after the crossing, unless the driver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(2)For this section, distances are
measured—(a)in the direction in which the driver
is driving; and(b)as shown in the example.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Reprint 2C
effective 30 November 2012Page 173
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 173]Example—Measurement of distance—pedestrian
crossing173Stopping on or near a marked foot
crossing (except at anintersection)(1)A
driver must not stop on a marked foot crossing that is not
atan intersection, or on the road within 10m
before the trafficlights pole nearest to the driver at the
crossing and 3m afterthe crossing, unless the
driver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(2)For this section, distances are
measured—(a)in the direction in which the driver
is driving; and(b)as shown in the example.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Page 174Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 174]Example—Measurement of distance—marked foot
crossing174Stopping at or near bicycle crossing
lights (except at anintersection)(1)This
section applies to a place on a road—(a)withbicyclecrossinglightsfacingbicycleriderscrossing the
road; and(b)withtrafficlightsfacingtraffictravellingontheroad;and(c)that is not at an intersection.(2)Adrivermustnotstopwithin10mbeforethetrafficlightsnearesttothedriverattheplace,and3mafterthetrafficlights, unless
the driver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(3)For this section, distances are
measured—(a)in the direction in which the driver
is driving; and(b)as shown in the example.(4)In this section—Reprint 2C
effective 30 November 2012Page 175
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 175]roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Example—Measurement of distance—bicycle
crossing lights175Stopping on or near a level
crossing(1)A driver must not stop on a level
crossing, or on a road within20m before the
nearest rail or track to the driver approachingthecrossingand20mafterthenearestrailortracktothedriver leaving the crossing, unless
the driver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(2)Forthissection,distancesaremeasuredasshownintheexample.(3)In
this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Page 176Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 176]Example—Measurement of distance—level
crossingDivision 4Stopping on
clearways andfreeways and in emergencystopping lanes176Stopping on a clearway(1)Adrivermustnotstoponalengthofroad,otherthanaroad-related area, to which a clearway sign
applies, unless thedriver is—(a)driving a bus or taxi; and(b)dropping off, or picking up,
passengers.Maximum penalty—20 penalty units.(2)A clearway sign applies, for the days
or times indicated on thesign, to a length of road beginning at
the sign and ending atthe nearest of the following—(a)a clearway sign on the road that
indicates different daysor times;(b)an
end clearway sign on the road;(c)the
end of the road.Reprint 2C effective 30 November 2012Page
177
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 177]Examples—Clearway signEnd clearway
signs177Stopping on a freeway(1)A driver must not stop on a freeway,
unless the driver stops inan emergency stopping lane.Maximum penalty—20 penalty units.(2)Afreewayis a
length of road to which a freeway sign applies.(3)A
freeway sign on a road applies to a length of road beginningat
the sign (including any road into which the length of roadmerges) and ending at the next end freeway
sign on the road.Examples of freeway signs—Page 178Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 178]Example of end freeway sign—178Stopping in an
emergency stopping laneA driver (except the rider of a
bicycle) must not stop in anemergency
stopping lane unless—(a)the condition of
the driver, a passenger or the driver’svehicle,oranyotherfactor,makesitnecessaryordesirableforthedrivertostopintheemergencystopping lane in
the interests of safety; and(b)thedriverstopsforno longerthanisnecessaryinthecircumstances.Maximum
penalty—20 penalty units.Division 5Stopping in
zones for particularvehicles179Stopping in a loading zone(1)A driver must not stop in a loading
zone, unless the driver isdriving—(a)a
bus that is dropping off, or picking up, passengers; or(b)a truck that is dropping off, or
picking up, passengers orgoods; or(c)amotorvehicledisplayingacommercialvehicleidentification label issued by the local
government forthe local government area in which the
loading zone issituated; orReprint 2C
effective 30 November 2012Page 179
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 179](d)another motor vehicle that is—(i)dropping off, or picking up, goods;
or(ii)dropping off, or
picking up, passengers.Maximum penalty—20 penalty
units.(2)Adriverwhoispermittedtostopinaloadingzoneundersubsection
(1)(a), (b) or (c) must not stay continuously in thezone
for longer than—(a)30 minutes; or(b)ifinformationonorwiththeloadingzonesignsapplyingtotheloadingzoneindicatesanothertime—the
indicated time.Maximum penalty—20 penalty units.(2A)Adriverwhoispermittedtostopinaloadingzoneundersubsection
(1)(d)(i) must not stay continuously in the zone forlonger than 20 minutes.Maximum
penalty—20 penalty units.(2B)Adriverwhoispermittedtostopinaloadingzoneundersubsection(1)(d)(ii)mustnot
staycontinuouslyinthezonefor longer than
2 minutes.Maximum penalty—20 penalty units.(3)Aloading
zoneis a length of a road to which a loading
zonesign applies.Example—Page 180Loading zone
signReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 180]180Stopping in a truck zone(1)A driver must not stop in a truck
zone, unless the driver isdriving a truck that is dropping off,
or picking up, passengersor goods.Maximum
penalty—20 penalty units.(2)Atruck zoneis a length of a
road to which a truck zone signapplies.Example—Truck
zone sign181Stopping in a works zone(1)A driver must not stop in a works
zone, unless the driver isdriving a vehicle that is engaged in
construction work in ornear the zone.Maximum
penalty—20 penalty units.(2)Aworks zoneis a length of a
road to which a works zone signapplies.Reprint 2C effective 30 November 2012Page
181
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 182]Example—Works zone sign182Stopping in a taxi zone(1)Adrivermustnotstopinataxizone,unlessthedriverisdriving a taxi.Maximum
penalty—20 penalty units.(2)Ataxi
zoneis a length of a road to which a taxi zone
signapplies.Example—Taxi zone sign183Stopping in a bus zone(1)Adrivermustnotstopinabuszone,unlessthedriverisdriving a bus (except a bus of a kind that
is not permitted tostop in the bus zone by information on or
with the bus zonesign applying to the bus zone).Page
182Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 184]Maximum penalty—20 penalty units.(2)Abuszoneisalengthofaroadtowhichabuszonesignapplies.Example—Bus zone sign184Section number not used185Stopping in a permit zone(1)A driver must not stop in a permit
zone, unless the driver’svehicle displays a current permit
issued under this regulationthat permits the
vehicle to stop in the zone.Maximum
penalty—20 penalty units.(2)Apermit zoneis a length of a
road to which a permit zonesign
applies.Reprint 2C effective 30 November 2012Page
183
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 186]Example—Permit zone sign186Stopping in a mail zone(1)A
driver must not stop in a mail zone.Maximum
penalty—20 penalty units.(2)Amail
zoneis a length of a road to which a mail zone
signapplies.Example—Mail zone signPage 184Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 187]Division 6Other places
where stopping isrestricted187Stopping in a bus lane, tram lane, tramway,
transit lane,truck lane or on tram tracks(1)A driver must not stop in a bus lane,
transit lane or truck lane,unless the
driver—(a)is—(i)driving a bus or taxi; and(ii)dropping off, or
picking up, passengers; or(b)is permitted to
drive in the lane under this regulation.Maximum
penalty—20 penalty units.(2)A driver (except
the driver of a tram, a tram recovery vehicleor a bus) must
not stop in a tram lane, a tramway or on tramtracks.Maximum penalty—20 penalty units.188Stopping in a shared zoneA
driver must not stop in a shared zone unless—(a)the
driver stops at a place on a length of road, or in anarea,towhichaparkingcontrolsignappliesandthedriver is
permitted to stop at that place under the Act; or(b)the driver—(i)stops in a parking bay; and(ii)is permitted to
stop in the parking bay under thisregulation;
or(c)the driver is dropping off, or picking
up, passengers orgoods; orReprint 2C
effective 30 November 2012Page 185
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 189](d)thedriverisengagedinthedoor-to-doordeliveryorcollectionofgoods,orinthecollectionofwasteorgarbage.Maximum
penalty—20 penalty units.189Double
parking(1)A driver must not stop on a
road—(a)if the road is a two-way road—between
the centre of theroad and another vehicle that is parked at
the side of theroad; or(b)if
the road is a one-way road—between the far side ofthe
road and another vehicle that is parked at the side ofthe
road.Maximum penalty—20 penalty units.(2)A driver does not contravene
subsection (1) by parking on thesideoftheroad,orinamedianstripparkingarea,inaccordance with section 210.Example—In the
example, the vehicle marked with an ‘X’ is stopped in contravention
of this section.190Stopping in or near a safety
zone(1)A driver must not stop in a safety
zone, or on a road within10m before or after a safety zone,
unless the driver—Page 186Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 191](a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(2)For this section, distances are
measured—(a)in the direction in which the driver
is driving; and(b)from the end of the structure;
and(c)as shown in example 2.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Examples—Example 1Safety zone
signExample 2Measurement of
distance—safety zoneIn example 2, the vehicles marked with an ‘X’
are stopped in contravention of this section.191Stopping near an obstructionA
driver must not stop on a road near an obstruction on theroad
in a position that obstructs traffic on the road.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
187
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 192]192Stopping on a bridge or in a tunnel
etc.(1)A driver must not stop on a bridge,
causeway, ramp or similarstructure unless—(a)the
road is at least as wide on the structure as it is oneach
of the approaches; or(b)the
driver—(i)stops at a place on a length of road,
or in an area, towhich a parking control sign applies;
and(ii)ispermittedtostopatthatplaceunderthisregulation.Maximum
penalty—20 penalty units.(2)A driver must
not stop in a tunnel or underpass unless—(a)the
road is at least as wide in the tunnel or underpass asit
is on each of the approaches; or(b)the
driver—(i)stops at a place on a length of road,
or in an area, towhich a parking control sign applies;
and(ii)ispermittedtostopatthatplaceunderthisregulation.Maximum
penalty—20 penalty units.Page 188Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 193]Example—Stopping on a bridge where the road on the
bridge is narrower than on an approachIn the example,
the vehicle is stopped in contravention of subsection (1).193Stopping on a crest or curve outside a
built-up area(1)A driver must not stop on or near a
crest or curve on a lengthof road that is not in a built-up area
unless—(a)thedriver’svehicleisvisiblefor100mtodriversapproaching the
vehicle and travelling in the direction oftraveloftrafficonthesamesideoftheroadasthevehicle;
or(b)the driver—(i)stops at a place on a length of road, or in
an area, towhich a parking control sign applies;
and(ii)ispermittedtostopatthatplaceunderthisregulation.Maximum
penalty—20 penalty units.(2)In this
section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of a road.Reprint 2C
effective 30 November 2012Page 189
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 194]194Stopping near a fire hydrant etc.(1)Adrivermustnotstopwithin1mofafirehydrant,firehydrant
indicator, or fire plug indicator, unless—(a)the
driver—(i)is driving a bus; and(ii)stops at a bus
stop or in a bus zone; and(iii)does not leave
the bus unattended; or(b)the
driver—(i)is driving a taxi; and(ii)stops in a taxi
zone; and(iii)does not leave
the taxi unattended.Maximum penalty—20 penalty
units.(2)For this section, a driver leaves a
vehicleunattendedif thedriverleavesthevehiclesothedriverisover3mfromtheclosest point of the vehicle.(3)In this section—firehydrantmeansanuprightpipewithaspout,nozzleorother outlet for drawing water from a
main or service pipe incase of fire or other
emergency.Examples—Page
190Fire hydrant indicatorsReprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 195]Fire
plug indicator195Stopping at or near a bus stop(1)A driver (except the driver of a bus)
must not stop at a busstop, or on the road, within 20m
before a sign on the road thatindicatesthebusstop,and10mafterthesign,unlessthedriver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(2)Forthissection,distancesaremeasuredinthedirectioninwhich the driver is driving.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.196Stopping at or near a tram stop(1)A driver (except the driver of a tram,
a tram recovery vehicleor a bus travelling along tram tracks)
must not stop at a tramstop or on the road within 20m before
a sign that indicates atram stop, unless—(a)the
driver stops at a place on a length of road, or in anarea, to which a parking control sign
applies; andReprint 2C effective 30 November 2012Page
191
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 197](b)thedriverispermittedtostopatthatplaceunderthisregulation.Maximum
penalty—20 penalty units.(2)For this
section, the distance is measured in the direction inwhich the driver is driving.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.197Stopping on a path, dividing strip, nature
strip or paintedisland(1)A
driver must not stop on a bicycle path, footpath, shared
pathor dividing strip, or a nature strip
adjacent to a length of roadin a built-up
area, unless the driver—(a)stopsataplaceonalengthofroad,orinanarea,towhich a parking control sign applies;
and(b)is permitted to stop at that place
under this regulation.Maximum penalty—20 penalty
units.(1A)A driver must
not stop on a painted island.Maximum
penalty—20 penalty units.(2)Subsection(1)doesnotapplytotheriderofabicycleoranimal.198Obstructing access to and from a footpath,
driveway etc.(1)A driver must not stop on a road in a
position that obstructsaccess by vehicles or pedestrians to
or from a footpath rampor a similar way of access to a
footpath, or a bicycle path orpassageway
unless—(a)the driver is driving a bus that is
dropping off, or pickingup, passengers; or(b)the
driver—(i)stops in a parking bay; andPage
192Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 198](ii)is permitted to
stop in the parking bay under thisregulation.Maximum
penalty—20 penalty units.(2)A driver must
not stop on or across a driveway or other way ofaccessforvehiclestravellingtoorfromadjacentlandunless—(a)the driver—(i)is
dropping off or picking up passengers; and(ii)does
not leave the vehicle unattended; and(iii)completesthedroppingofforpickingupofthepassengers,anddriveson,assoonaspracticableand, in any
case, within 2 minutes after stopping;or(b)the driver—(i)stops in a parking bay; and(ii)is permitted to
stop in the parking bay under thisregulation.Maximum
penalty—20 penalty units.(3)For subsection
(2)(a)(ii), a driver leaves a vehicle unattendedifthedriverismorethan3mfromtheclosestpartofthevehicle.Reprint 2C effective 30 November 2012Page
193
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 199]Example—Blocking a drivewayIn the
example, the vehicle marked with an ‘X’ is stopped in contravention
of subsection(2).199Stopping near a
postboxAdrivermustnotstoponaroadwithin3mofapublicpostbox
unless—(a)the driver is dropping off, or picking
up, passengers ormail; or(b)the
driver—(i)stops at a place on a length of road,
or in an area, towhich a parking control sign applies;
and(ii)ispermittedtostopatthatplaceunderthisregulation.Maximum
penalty—20 penalty units.200Stopping on
roads—heavy and long vehicles(1)The
driver of a heavy vehicle, or long vehicle, must not stopon a
length of road that is not in a built-up area, except on theshoulder of the road.Maximum
penalty—20 penalty units.Page 194Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 201](2)Subject to subsections (2A) and (2B),
the driver of a heavyvehicle, or long vehicle, must not
stop on a length of road in abuilt-upareaforlongerthan1hour,unlessthedriverispermitted to stop on the length of road for
longer than 1 hourby information on or with a traffic control
device.Maximum penalty—20 penalty units.(2A)The driver of a
heavy vehicle, or long vehicle, may stop on alength of road
in a built-up area for longer than 1 hour if thedriver is engaged in dropping off or picking
up goods for all ofthe period when the vehicle is
stopped.(2B)Subsections (2)
and (2A) apply unless a local law otherwiseprovides.(3)In this section—long
vehiclemeans a vehicle that, together with any load
orprojection, is 7.5m long, or longer.roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of a road.201Stopping on a road with bicycle parking
signAdriver(excepttheriderofabicycle)mustnotstoponalength of road to which a bicycle
parking sign applies, unlessthe driver is
dropping off, or picking up, passengers.Maximum
penalty—20 penalty units.Example—Bicycle parking signReprint 2C
effective 30 November 2012Page 195
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 202]202Stopping on a road with motorbike parking
signA driver (except the rider of a motorbike)
must not stop on alengthofroadtowhichamotorbikeparkingsignapplies,unless the driver is dropping off, or
picking up, passengers.Maximum penalty—20 penalty
units.Example—Motorbike parking sign203Stopping in a parking area for people with
disabilities(1)Adrivermustnotstopinaparkingareaforpeoplewithdisabilities unless—(a)the
driver’s vehicle displays a current parking permit forpeople with disabilities; and(b)thedrivercomplieswiththeconditionsofuseofthepermit.Maximum
penalty—20 penalty units.(2)Aparking area for people with
disabilitiesis a length or areaof a
road—(a)to which a permissive parking sign
displaying a peoplewith disabilities symbol applies; or(b)to which a people with disabilities
parking sign applies;orPage 196Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 203A](c)indicated by a road marking (apeople with disabilitiesroadmarking)thatconsistsof,orincludes,apeoplewith
disabilities symbol.Examples—People with disabilities symbolsPermissive parking sign displaying apeople
with disabilities symbol (for alength of
road)Permissive parking sign displaying apeople with disabilities symbol (for
anarea)People with
disabilities parking sign203AStopping in a
slip laneA driver must not stop in a slip lane
unless—Reprint 2C effective 30 November 2012Page
197
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 204](a)aparkingcontrolsignappliestotheplacewherethedriver stops; and(b)thedriverispermittedtostopattheplaceunderthisregulation.Maximum
penalty—20 penalty units.Division 7Permissive
parking signs andparking fees204Meaning of particular information on or with
permissiveparking signs(1)This
section explains the meaning of certain information on orwith
a permissive parking sign applying to a length of road oran
area.Examples—Permissive parking sign (for a length
ofroad)Permissive parking sign (for an
area)Page 198Permissive
parking sign (for a length of road)Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 204](2)Awholenumber,fraction,orwholenumberandfraction,immediately to
the left of the letter ‘P’ indicates that a drivermustnotparkonthelengthofroad,orinthearea,continuously for longer than the period of
hours, or fraction ofan hour, equal to the number,
fraction, or number and fraction,shown.Examples of permissive parking signs showing
permitted parking periodsand times of operation—Example 1Example 2Permissive parking sign applying to aPermissive parking sign applying to
anlength of road with a whole number to
thearea with a whole number to the left of
Pleft of PIn example 1, the
sign indicates that a driver must not park continuously for longer
than 1hour on Saturdays between 9a.m. and
midday.In example 2, the sign indicates that, unless
permitted by information on or with anothertraffic control
device, a person must not park in the area for longer than 2 hours
on—•Mondays to Fridays between 8.30a.m.
and 5p.m.•Saturdays between 8.30a.m. and
midday.(3)A number, together with the word
‘minute’, immediately tothe right of the letter ‘P’ indicates
that a driver must not parkon the length of
road, or in the area, continuously for longerthan the number
of minutes shown.Reprint 2C effective 30 November 2012Page
199
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 205]Example—Example 3Permissive
parking sign with a number of minutes to the right of PIn
this example, the sign indicates that a driver must not park
continuously for longer than5 minutes between
9a.m. and 4p.m. on Mondays to Fridays.(4)The
word ‘parking’, together with words indicating a numberof
hours or minutes, indicates that a driver must not park onthe
length of road, or in the area, continuously for longer thanthe
number of hours or minutes shown.205Parking for longer than indicated(1)A driver must not park continuously on
a length of road, or inan area, to which a permissive parking
sign applies for longerthan—(a)the
period indicated by information on or with the sign;or(b)ifsection206appliestothedriver—theperiodpermitted under that section.Maximum penalty—20 penalty units.(1A)Ifapermissiveparkingsigndoesnotindicateaperiodanddoesnotindicatethatitappliesatparticulartimes,oratparticular times
on particular days, a driver may, at any time,park
continuously on a length of road, or in an area, to whichthe
sign applies, unless—(a)anotherparkingcontrolsignappliestothelengthofroad or area; andPage 200Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 205A](b)thedriverisprohibitedfromparkingonthelengthofroad, or in the area, under this
regulation.(2)For subsection (1), a driver parks
continuously on a length ofroad, or in an
area, to which a permissive parking sign appliesfrom
the time when the driver parks on the length of road or inthe
area until the driver or another driver moves the vehicle
offthe length of road or out of the
area.205AParking outside times indicatedIfapermissiveparkingsignindicatesthatitappliesatparticulartimes,oratparticulartimesonparticulardays,adriver may park on the length of road,
or in an area, to whichthe sign applies at a time, or at a
time on a day, when the signdoes not apply,
unless—(a)anotherparkingcontrolsignappliestothelengthofroad
or area; and(b)thedriverisprohibitedfromparkingonthelengthofroad, or in the area, at that time, or at
that time on thatday, under this regulation.206Time extension for people with
disabilities(1)This section applies to a driver
if—(a)the driver’s vehicle displays a
current parking permit forpeople with disabilities; and(b)thedrivercomplieswiththeconditionsofuseofthepermit.(2)The
driver may park continuously on a length of road, or in anarea, to which a permissive parking sign
applies—(a)if the time limit on the sign is less
than 30 minutes—for30 minutes; or(b)if
the time limit on the sign is 30 minutes or more—foran
unlimited time.Reprint 2C effective 30 November 2012Page
201
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 207]207Section number not usedDivision 8Parallel parking208Parallel parking on a road (except in a
median stripparking area)(1)Adriverwhoparksonaroad(exceptinamedianstripparking area)
must position the driver’s vehicle in accordancewith
subsections (2) to (8).Maximum penalty—20 penalty
units.(2)The driver must position the vehicle
to face—(a)in the direction of travel of vehicles
in the marked laneor line of traffic on, or next to, the part
of the road wherethe driver parks; or(b)ifthereisnotrafficon,ornextto,thepartoftheroad—inthedirectioninwhichvehiclesordinarilytravel on, or
next to, the part of the road.(3)Iftheroadisatwo-wayroad,thedrivermustpositionthevehicle parallel, and as near as
practicable, to the far left sideof the
road.(4)Iftheroadisaone-wayroad,thedrivermustpositionthevehicle parallel, and as near as
practicable, to the far left or farrightsideoftheroad,unlessotherwiseindicatedbyinformation on or with a parking
control sign.(5)If the driver does not park in a
parking bay, the driver mustposition the
vehicle at least 1m from the closest point of anyvehicle in front of it and any vehicle
behind it.(6)If the road has a continuous dividing
line or a dividing strip,thedrivermustpositionthevehicleatleast3mfromthecontinuousdividinglineordividingstrip,unlessotherwiseindicated by information on or with a
parking control sign.(7)Iftheroaddoesnothaveacontinuousdividinglineoradividing strip, the driver must
position the vehicle so there isat least 3m of
the road alongside the vehicle that is clear forPage
202Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 208]othervehiclestopass,unlessotherwiseindicatedbyinformation on or with a parking
control sign.(8)The driver must position the vehicle
so the vehicle does notunreasonablyobstructthepathofothervehiclesorpedestrians.(9)This
section does not apply to—(a)a driver if the
driver parks on a length of road, or in anarea, to which a
parking control sign or road markingapplies,andinformationonorwiththesignorroadmarking includes
the words ‘angle parking’ or ‘angle’;or(b)the rider of a motorbike if the rider
parks the motorbikeon a length of road, or in an area, to which
a permissiveparkingsignappliesandthesignindicatesthatthelength of road or area is for parking
motorbikes.(10)Subsections(3)and(4)donotapplytotheriderofamotorbikeiftheriderpositionsthemotorbikesoatleast1wheel is as near as practicable to the far
left or far right side ofthe road.(11)If a
road has 1 or more service roads, the part of the road usedby
the main body of moving vehicles, and each service road,is
taken to be a separate road for this section.(12)In
this section—continuous dividing linemeans—(a)a single continuous dividing line
only; or(b)a single continuous dividing line to
the left or right of abroken dividing line; or(c)2 parallel continuous dividing
lines.roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Reprint 2C
effective 30 November 2012Page 203
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 208A]Example—Parallel parking—minimum distance from other
vehicles and dividing stripIn the example, the vehicles marked
with an ‘X’ are parked in contravention of thissection.208AParallel parking in a road-related
area (except in a medianstrip parking area)(1)A driver who parks in a road-related
area (except in a medianstrip parking area) must position the
driver’s vehicle to face—(a)in the direction
of travel of vehicles in the marked laneor line of
traffic next to the part of the road-related areawhere the driver parks; or(b)if there is no traffic next to that
part of the road-relatedarea—in the direction in which
vehicles could lawfullytravel in the road-related area;
or(c)iftheroad-relatedareaisanareathatdividesaroad—either—(i)in
the direction of travel of vehicles in the markedlane
or line of traffic to the left of the driver; or(ii)if there is no
traffic to the left of the driver—in thedirection in
which vehicles could lawfully travel onthat part of the
road.Page 204Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 209]Maximum penalty—20 penalty units.(2)Subsection(1)doesnotapplyifsignsorroadmarkingsindicate that angle parking is required in
the road-related area.209Parallel parking
in a median strip parking area(1)This
section applies to a driver who parks in a median stripparking area if a parking control sign or
road marking appliestothearea,andinformationonorwiththesignorroadmarking
indicates that the driver’s vehicle must be positionedparallel to the median strip.(2)The driver must position the driver’s
vehicle—(a)to face—(i)in
the direction of travel of vehicles in the markedlane
or line of traffic to the left of the driver; or(ii)if there is no
traffic to the left of the driver—in thedirection in
which vehicles ordinarily travel on thepart of the road
to the left of the driver; and(b)parallel, and as near as practicable, to the
centre of themedian strip; and(c)if
the driver does not park in a parking bay—at least 1mfrom
the closest point of any vehicle in front of it andany
vehicle behind it.Maximum penalty—20 penalty units.(3)This section does not apply to the
rider of a motorbike.Division 9Angle
parking210Angle parking(1)If a
driver parks in a parking area on the side of a road, or in
amedian strip parking area, to which a
parking control sign orroadmarkingapplies,andinformationonthesignincludesthewords‘angleparking’or‘angle’,ortheroadmarkingReprint 2C effective 30 November 2012Page
205
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 210]indicatesaparticularangleforparking,thedrivermustposition the driver’s vehiclein
accordance with subsections(2) to
(4).Maximum penalty—20 penalty units.(2)If the parking control sign or road
marking indicates that thevehicle must be positioned at a stated
angle, other than 90°,the driver must position the
vehicle—(a)at an angle as near as practicable to
the stated angle; and(b)if the vehicle
is parked on the side of the road—with therear of the
vehicle nearest to the centre of the road.(2A)If
the parking control sign or road marking does not indicatean
angle at which the vehicle must be positioned, the drivermust
position the vehicle—(a)at an angle as
near as practicable to 45°, as shown inexample 1 or 2;
and(b)if the vehicle is parked on the side
of the road—with therear of the vehicle nearest to the
centre of the road.Page 206Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 210]Examples—Example 1Example 2Parking at 45° at the side of a
two-wayParking at 45° at the side of a
one-wayroadroad(2B)Subsections (2) and (2A) do not apply if the
road marking orinformationontheparkingcontrolsignincludesthewords‘rear in’, or
similar words.(3)If the parking control sign or road
marking indicates that thevehicle must be positioned at an angle
of 90º, the driver—(a)must position the driver’s vehicle so
the vehicle is at anangle as near as practicable to 90º,
as shown in example3 or 4; and(b)if
the vehicle is parked on the side of the road—(i)iftheroadmarking,orinformationonthesign,includesthewords‘rearin’,orsimilarwords—must
position the vehicle with the front ofthe vehicle
nearest to the centre of the road; orReprint 2C
effective 30 November 2012Page 207
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 210](ii)iftheroadmarking,orinformationonthesign,includesthewords‘frontin’orsimilarwords—must position the vehicle with the
rear ofthe vehicle nearest to the centre of the
road; or(iii)otherwise—maypositionthevehiclewitheitherthe front or
rear of the vehicle nearest to the centreof the
road.Examples—Example 3Parking at 90º at
the side of a two-wayroadExample 4Parking at 90º at the right side of aone-way road(4)Iftheroadmarking,orinformationontheparkingcontrolsign, includes the words ‘rear in’, or
similar words, the drivermust position the vehicle—(a)at an angle as near as practicable
to—(i)iftheroadmarkingorsignindicatesthatthevehicle must be positioned at a stated
angle—thestated angle; or(ii)iftheroadmarkingorsigndoesnotindicateanangleatwhichthevehiclemustbepositioned—45°; andPage
208Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 210](b)if the vehicle is parked on the side
of the road—with thefront of the vehicle nearest to the
centre of the road.Examples—Example 5Example 6Parking rear in at 30° at the side of a
roadParking rear in at 30° in a median
stripparking areaReprint 2C
effective 30 November 2012Page 209
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 210]Example 7Example 8Parking rear in at
45° at the side of a roadParking rear in at 45° in a median
stripparking areaPage 210Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 211]Example 9Example 10Parking rear in at 60° at the side of a
roadParking rear in at 60° in a median
stripparking area(4A)Subsection(4)doesnotapplyiftheparkingsignorroadmarkingindicatesthatthevehiclemustbepositionedatanangle of 90°.(5)This
section does not apply to the rider of a motorbike.Division 10Other parking
related rules211Parking in parking bays(1)This section applies to a driver who
parks on a length of road,or in an area, that has parking bays
(whether or not a park inbays only sign applies to the length
of road or area).Reprint 2C effective 30 November 2012Page
211
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 212]Example—Park in bays only sign(2)Thedrivermustpositionthedriver’svehiclecompletelywithin a single
parking bay, unless the vehicle is too wide orlong to fit
completely within the bay.Maximum penalty—20 penalty
units.(3)If the vehicle is too wide or long to
fit completely within asingle parking bay, the driver must
park the driver’s vehiclewithin the minimum number of parking
bays needed to parkthe vehicle.Maximum
penalty—20 penalty units.212Entering and
leaving a median strip parking area(1)If
information on or with a traffic control device indicates
thata driver must enter or leave a median strip
parking area in aparticular direction, the driver must enter
or leave the area inthat direction.Maximum
penalty—20 penalty units.(2)If there is no
information on or with a traffic control devicethat indicates
that a driver must enter or leave a median stripparking area in a particular direction, the
driver must enter orleave the area by driving
forward.Maximum penalty—20 penalty units.Page
212Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 12
Restrictions on stopping and parking[s 213]Example—Leaving median strip parking area by driving
forward213Making a motor vehicle secure(1)This section applies to the driver of
a motor vehicle who stopsand leaves the vehicle on a road,
unless the driver need notcomplywiththesectionunderanotherprovisionofthisregulation.(2)Before leaving the vehicle, the driver
must—(a)apply the vehicle’s parking brake
effectively; or(b)ifweatherconditions,forexample,snow,preventtheeffectiveoperationoftheparkingbrake—effectivelyrestrain the
vehicle’s movement in another way.Maximum
penalty—20 penalty units.(3)Also, before
leaving the vehicle the driver must switch off theengine if the driver will be more than 3m
from the closest partof the vehicle.Maximum
penalty—20 penalty units.Reprint 2C effective 30 November
2012Page 213
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 12 Restrictions on stopping and
parking[s 213A](4)In
addition, before leaving the vehicle the driver must removethe
ignition key if there is no-one 16 years or older remainingin
the vehicle.Maximum penalty—20 penalty units.(5)Ifthedriverwillbeover3mfromtheclosestpartofthevehicleandthereisno-oneleftinthevehicle,thedrivermust—(a)ifthewindowsofthevehiclecanbesecured—securethewindowsimmediatelybeforeleavingthevehicle;and(b)if the doors of the vehicle can be
locked—lock the doorsimmediately after leaving the
vehicle.Maximum penalty—20 penalty units.(6)For subsection (5), a window is secure
even if it is open by upto 50mm.(7)Subsections (3) to (5) do not apply
to—(a)thedriverofawastemanagementvehiclewhileemptying or
collecting wheelie bins; or(b)the
driver of an armoured vehicle while on duty.213AEvidentiary provisionFor this part,
evidence that a vehicle was found stationary at aplace is evidence that the vehicle was
parked or stopped at theplace.Page 214Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 13 Lights
and warning devices[s 214]Part 13Lights and warning devicesDivision 1Lights on
vehicles (except bicycles,animals and animal-drawn
vehicles)214Division does not apply to riders of
bicycles, animals oranimal-drawn vehiclesThis division
does not apply to the rider of a bicycle, animalor
animal-drawn vehicle.215Using lights when
driving at night or in hazardousweather
conditions(1)Adrivermustnotdriveatnight,orinhazardousweatherconditions causing reduced visibility
unless—(a)the headlights, tail lights and number
plate light fitted tothedriver’svehicleareoperatingeffectivelyandareclearly visible; and(b)ifthevehicleisfittedwithclearancelightsorsidemarker
lights—those lights are operating effectively andare
clearly visible.Maximum penalty—20 penalty units.(2)However, this section does not apply
to a driver if—(a)the driver’s vehicle is stopped or
parked at a place on alength of road, or in an area, to
which a parking controlsign applies; and(b)the
driver is permitted to stop or park at that place underthis
regulation.(3)Also,adriverdrivingduringthedayinfog,orotherhazardous
weather conditions causing reduced visibility, maydrive without the headlights of the driver’s
vehicle operatingif the vehicle is fitted with front fog
lights and those lights areoperating
effectively and are clearly visible.Reprint 2C
effective 30 November 2012Page 215
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 13 Lights and warning
devices[s 216](4)Insubsection(1),areferencetoakindoflightfittedtoavehicleisareferencetoalightofthatkindrequiredtobefittedtothevehicleundertheStandardsandSafetyRegulation.216Towing a vehicle at night or in hazardous
weatherconditions(1)Adrivermustnottowavehicleatnight,orinhazardousweather
conditions causing reduced visibility, unless—(a)if
the towed vehicle is being towed from the front of thevehicle—(i)thetaillightsofthevehicleareoperatingeffectively and
are clearly visible; or(ii)thevehiclehasportablerearlightsthatareoperating; or(b)if
the towed vehicle is being towed from the rear of thevehicle—thevehiclehasportablerearlightsthatareoperating.Maximum
penalty—20 penalty units.(2)However, this
section does not apply to the driver of a towtruck if—(a)the driver is towing a disabled
vehicle carrying a placardload of dangerous goods to a place
that is safely off theroad; and(b)a
vehicle carrying a warning to other traffic is followingimmediately behind the disabled
vehicle.(3)In this section—dangerousgoodshasthemeaninggivenbytheTransportOperations(RoadUseManagement—DangerousGoods)Regulation
2008.placardloadhasthemeaninggivenbytheTransportOperations(RoadUseManagement—DangerousGoods)Regulation
2008.Page 216Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 13 Lights
and warning devices[s 217]portable rear
lightsmeans—(a)foravehiclebeingtowedfromthefrontofthevehicle—apairoflightsattachedtotherearofthevehiclethat,whenoperating,showaredlightthatisclearlyvisibleforatleast200mfromtherearofthevehicle; or(b)for
a vehicle being towed from the rear of the vehicle—apairoflightsattachedtothefrontofthevehiclethat,when operating,
show a red light that is clearly visiblefor at least
200m from the front of the vehicle.roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.217Using
fog lights(1)The driver of a vehicle fitted with a
front fog light or rear foglight must not
operate the fog light unless the driver is drivingin
fog or other hazardous weather conditions causing reducedvisibility.Maximum
penalty—20 penalty units.(2)In this
section—front fog lightmeans a light
(other than a headlight) fitted tothe front of a
vehicle to improve illumination of the road infog, snowfall,
heavy rain or dust clouds.rear fog lightmeans a light
(other than a brake light, a taillight, a number
plate light or a reversing light) fitted to therear of a
vehicle to make the vehicle more easily visible fromthe
rear in fog, snowfall, heavy rain or dust clouds.218Using headlights on high-beam(1)The driver of a vehicle must not use
the vehicle’s headlightson high-beam, or allow the vehicle’s
headlights to be used onhigh-beam, if the driver is
driving—(a)less than 200m behind a vehicle
travelling in the samedirection as the driver; orReprint 2C effective 30 November 2012Page
217
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 13 Lights and warning
devices[s 219](b)less
than 200m from an oncoming vehicle.Maximum
penalty—20 penalty units.(2)However, if the
driver is overtaking a vehicle, the driver maybrieflyswitchtheheadlightsfromlow-beamtohigh-beamimmediately
before the driver begins to overtake the vehicle.Examples—Example 1Using
headlights on low-beam when travelling less than 200m behind
another vehicletravelling in the same directionExample 2Using headlights
on low-beam when travelling within 200m of an oncoming
vehicle219Lights not to be used to dazzle other
road usersA driver must not use, or allow to be used,
any light fitted toor in the driver’s vehicle to dazzle, or in
a way that is likely todazzle, another road user.Maximum penalty—20 penalty units.220Using lights on vehicles that are
stopped(1)A driver must not stop on a road at
night unless—Page 218Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 13 Lights
and warning devices[s 221](a)ifthedriver’svehicleis2.2mwide,orwider—theclearance and
side marker lights fitted to the vehicle areoperating
effectively and are clearly visible; or(b)inanyothercase—theparkinglightsfittedtothedriver’s vehicle
are operating effectively and are clearlyvisible.Maximum penalty—20 penalty units.(2)This section does not apply to a
driver if the driver stops on alengthofroad,orinanarea,withstreetlightingandthedriver’s vehicle is visible for at
least 200m in all directionsfrom the
vehicle.(3)Insubsection(1),areferencetoakindoflightfittedtoavehicleisareferencetoalightofthatkindrequiredorpermitted to be fitted to the vehicle under
the Standards andSafety Regulation.(4)In
this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.221Using
hazard warning lightsThe driver of a vehicle fitted with
hazard warning lights mustnot use the hazard warning lights, or
allow them to be used,unless—(a)the
vehicle is stopped and is obstructing, or is likely toobstruct, the path of other vehicles or
pedestrians; or(b)the vehicle is a slow-moving vehicle
and is obstructing,orislikelytoobstruct,thepathofothervehiclesorpedestrians; or(c)the
vehicle is stopped in an emergency stopping lane; or(d)thedriverstopsthevehicletosellaproduct(forexample, ice creams) that may attract
children onto theroad; or(e)thedriverisdrivinginhazardousweatherconditions(for example,
fog or smoke); orReprint 2C effective 30 November 2012Page
219
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 13 Lights and warning
devices[s 222](f)thehazardwarninglightsareoperatingaspartofananti-theft device, or an alcohol
ignition interlock, fittedto the vehicle.Maximum
penalty—20 penalty units.222School bus not to
be driven without warning lights andwarning
signsA person must not drive a school bus unless
it is fitted withwarningsignsandwarninglightsunderthepassengertransport
standard, schedule 1, section 19.Maximum
penalty—20 penalty units.222AUse of warning
lights—picking up or setting down schoolchildren(1)This section applies to the driver of
a vehicle, whether or not aschool bus,
fitted with warning lights and warning signs underthepassengertransportstandard,schedule1,section19or25(1).(2)The
driver must—(a)ifthedriverintendstostoptopickuporsetdownchildren—signalthatintentionbysimultaneouslyactivating the
warning lights, at least 5 seconds beforethebusstops,unlessthewarninglightsarealreadyoperatingunderthepassengertransportstandard,schedule 1,
section 24(3); and(b)keep the warning lights activated
until at least 5 secondsafter the vehicle has started to move
off after stopping.Maximum penalty—20 penalty units.(3)The driver must ensure the warning
lights are not activated,otherthanundersubsection(2)orthepassengertransportstandard,
schedule 1, section 24(3), while the vehicle is on aroad, unless the driver has a reasonable
excuse.Example—The
driver is testing the lights to ensure their satisfactory
operation.Page 220Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 13 Lights
and warning devices[s 223]Maximum
penalty—20 penalty units.(4)Thissectionappliesdespitetherequirementunderthepassengertransportstandard,schedule1,section24(3)thatthevehiclebefittedwithautomaticallyoperatingwarninglights.Division 2Lights on
animal-drawn vehicles223Using lights when
riding an animal-drawn vehicle at nightor in hazardous
weather conditionsA person must not ride an animal-drawn
vehicle at night, or inhazardousweatherconditionscausingreducedvisibility,unless the
vehicle is fitted with, and displays—(a)a
white light fitted at or towards the front of each side ofthe
vehicle that is clearly visible for at least 200m fromthe
front of the vehicle; and(b)a red light
fitted at or towards the rear of each side of thevehicle that is clearly visible for at least
200m from therear of the vehicle; and(c)a
red reflector fitted at or towards the rear of each side ofthe
vehicle that is—(i)not over 1.5m above ground level;
and(ii)clearly visible
for at least 50m from the rear of thevehicle when
light is projected onto it by anothervehicle’s
headlight on low-beam.Maximum penalty—20 penalty
units.Division 3Horns and radar
detectors224Using horns and similar warning
devicesA driver must not use, or allow to be used,
a horn, or similarwarning device, fitted to or in the driver’s
vehicle unless—Reprint 2C effective 30 November 2012Page
221
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 13 Lights and warning
devices[s 225](a)itisnecessarytousethehorn,orwarningdevice,towarnotherroadusersoranimalsoftheapproachorposition of the vehicle; or(b)the horn, or warning device, is being
used as part of ananti-theft device, or an alcohol ignition
interlock, fittedto the vehicle.Maximum
penalty—20 penalty units.225Using radar
detectors and similar devices(1)A
person must not drive a vehicle if the vehicle, or a trailerbeing towed by the vehicle, has in or on
it—(a)adeviceforpreventingtheeffectiveuseofaspeedmeasuring device; or(b)adevicefordetectingtheuseofaspeedmeasuringdevice.Maximum
penalty—40 penalty units.(2)A person who is
travelling in or on a vehicle or trailer mustnot have in the
person’s possession a device for preventing theeffectiveuseofaspeedmeasuringdevice,oradevicefordetecting the use of a speed measuring
device.Maximum penalty—40 penalty units.(3)Subsections(1)and(2)applywhetherornotthedeviceisoperating or in working order.Page
222Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 13 Lights
and warning devices[s 226]Division 4Portable warning triangles for heavyvehicles226Heavy
vehicles to be equipped with portable warningtrianglesA
person must not drive a vehicle with a GVM over 12t unlessthevehicleisequippedwithatleast3portablewarningtriangles.Maximum
penalty—20 penalty units.227Using portable
warning triangles(1)ThissectionappliestoadriveriftheGVMofthedriver’svehicle is over
12t.(2)If the driver stops on a road and the
vehicle is not visible atany time for at least 200m in all
directions from the vehicle,thedrivermustuseatleast3portablewarningtriangles,positionedinaccordancewithsubsection(4),towarnotherroad
users of the vehicle.Maximum penalty—20 penalty
units.(3)If some or all of any load being
carried by the vehicle fallsonto a road and
is not clearly visible at any time for at least200m in all
directions from the fallen load, the driver must useat
least 3 portable warning triangles, positioned in accordancewithsubsection(4),towarnotherroadusersofthefallenload.Maximum
penalty—20 penalty units.(4)The driver must
position the portable warning triangles so—(a)1
triangle is at least 50m, but not over 150m, in front ofthe
vehicle or fallen load; and(b)1
triangle is at least 50m, but not over 150m, behind thevehicle or fallen load; andReprint 2C effective 30 November 2012Page
223
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 13 Lights and warning
devices[s 227A](c)1
triangle is at the side of the vehicle, or fallen load, in aposition that gives sufficient warning to
other road usersof the position of the vehicle or fallen
load.(5)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of a road.Division 5Signs for oversize vehicles227ADo not overtake turning vehicle signs
for long vehiclesA person must not drive a vehicle displaying
a do not overtaketurning vehicle sign if the vehicle,
together with any load orprojection, is not 7.5m long, or
longer.Maximum penalty—20 penalty units.227BWarning sign not to be displayed if
not required by lawApersonmustnotdriveavehicledisplayinganoversizewarning sign
unless—(a)the person is required under the Act
or another Act todisplay the sign; or(b)the
vehicle is temporarily in Queensland on a journeyfrom
another State and the sign must be displayed on thevehicle under the law of the other
State.Maximum penalty—20 penalty units.Page
224Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 228]Part 14Rules
for pedestriansDivision 1General228No pedestrian signsA
pedestrian must not travel past a no pedestrians sign.Maximum penalty—20 penalty units.Example—No
pedestrians sign229Pedestrians on a road with a road
access signA pedestrian must not be on a length of road
to which a roadaccess sign applies if information on or
with the sign indicatesthat pedestrians are not permitted
beyond the sign.Maximum penalty—20 penalty units.Example—Road
access signReprint 2C effective 30 November 2012Page
225
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
230]230Crossing a road—general(1)A pedestrian crossing a road—(a)must cross by the shortest safe route;
and(b)must not stay on the road longer than
necessary to crossthe road safely.Maximum
penalty—20 penalty units.(2)However,ifthepedestrianiscrossingtheroadatanintersectionwithtrafficlightsandapedestriansmaycrossdiagonally sign,
the pedestrian may cross the road diagonallyat the
intersection.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Example—Pedestrians may cross diagonally
sign231Crossing a road at pedestrian
lights(1)Apedestrianapproachingoratanintersection,oranotherplace on a road,
with pedestrian lights and traffic lights mustcomply with this
section.Maximum penalty—20 penalty units.(2)Ifthepedestrianlightsshowaredpedestrianlightandthepedestrian has
not already started crossing the intersection orPage
226Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 231]road, the
pedestrian must not start to cross until the pedestrianlights change to green.(3)If,whilethepedestrianiscrossingtheroad,thepedestrianlights change to
flashing red or red, the pedestrian must notstay on the road
for longer than necessary to cross safely tothe nearer (in
the direction of travel of the pedestrian) of thefollowing—(a)adividing strip, safety zone,ortrafficisland,formingpart of the area
set aside or used by pedestrians to crossthe road at the
intersection or place (thesafety area);(b)the nearest side of the road.(4)If, under subsection (3), the
pedestrian crosses to the safetyarea, the
pedestrian must remain in the safety area until thepedestrian lights change to green.(5)However,ifthepedestriancannotoperatethepedestrianlights from the
safety area, the pedestrian may cross to the farside
of the road when—(a)the traffic lights change to green or
flashing yellow, orthere is no red traffic light showing;
and(b)it is safe to do so.(6)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Examples—Red pedestrian light showing redpedestrian symbolGreen pedestrian
light showing greenpedestrian symbolReprint 2C
effective 30 November 2012Page 227
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
232]232Crossing a road at traffic
lights(1)Apedestrianapproachingoratanintersection,oranotherplaceonaroad,withtrafficlights,butwithoutpedestrianlights must
comply with this section.Maximum penalty—20 penalty
units.(2)If the traffic lights show a red or
yellow traffic light and thepedestrian has
not already started crossing the intersection orroad, the pedestrian must not start to cross
until—(a)the traffic lights change to green or
flashing yellow; or(b)there is no red traffic light
showing.(3)If, while the pedestrian is crossing
the road, the traffic lightschange to yellow
or red, the pedestrian must not stay on theroad for longer
than necessary to cross safely to the nearer (inthe
direction of travel of the pedestrian) of the following—(a)adividing strip,
safety zone,ortrafficisland,formingpart of the area
set aside or used by pedestrians to crossthe road at the
intersection or place (thesafety area);(b)the nearest side of the road.(4)If, under subsection (3), the
pedestrian crosses to the safetyarea, the
pedestrian must remain in the safety area until—(a)the traffic lights change to green or
flashing yellow; or(b)there is no red traffic light
showing.(5)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.233Crossing a road to or from a tram(1)A pedestrian must not cross a road to
get on a tram at a tramstop until the tram has stopped at the
tram stop.Maximum penalty—20 penalty units.(2)A pedestrian crossing a road after
getting off a tram—Page 228Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 234](a)must
cross to the nearest footpath by the shortest saferoute or, if there is no footpath,crosstheroadbytheshortest safe route; and(b)must not stay on the road for longer
than necessary tocross the road safely.Maximum
penalty—20 penalty units.(3)This section
does not apply to a pedestrian—(a)on a
safety zone; or(b)crossing a road to or from a safety
zone.(4)Subsection (2) does not apply
to—(a)a pedestrian in a shared zone;
or(b)anemployeeofapublictransportoperatorwhoisinuniformandengagedincarryingouttheemployee’sduties.(5)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.tramincludes a bus travelling along tram
tracks.234Crossing a road on or near a crossing
for pedestrians(1)A pedestrian must not cross a road, or
part of a road, within20mofacrossingontheroad,exceptatthecrossingoranother crossing, unless the
pedestrian is—(a)crossing, or helping another
pedestrian to cross, an areaof the road
between tram tracks and the far left side ofthe road to get
on, or after getting off, a tram or bus; or(b)crossing to or from a safety zone; or(c)crossingatanintersectionwithtrafficlightsandapedestrians may
cross diagonally sign; or(d)crossing in a
shared zone; orReprint 2C effective 30 November 2012Page
229
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
235](e)crossing a road, or a part of a road,
from which vehiclesare excluded, either permanently or
temporarily.Maximum penalty—20 penalty units.(2)A pedestrian must not stay on a
crossing on a road for longerthan necessary
to cross the road safely.Maximum penalty—20 penalty
units.(3)Subsection (2) does not apply to a
person who is a crossingsupervisor under the Act.(4)In this section—crossingmeans a children’s crossing, marked foot
crossing orpedestrian crossing.Example—Pedestrians may cross diagonally
sign235Crossing a level crossing(1)A pedestrian must not cross a railway
line, or tram tracks, at alevel crossing unless—(a)thereisapedestrianfacilityatthecrossingandthepedestrian uses
the facility; or(b)there is no pedestrian facility at, or
within 20m of, thecrossing.Maximum
penalty—20 penalty units.(2)A pedestrian
must not cross a railway line, or tram tracks, at alevel crossing if—Page 230Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 235A](a)warning lights (for example, twin red lights
or rotatingred lights) are flashing or warning bells
are ringing; or(b)agate,boomorbarrieratthecrossingisclosedorisopening or closing; or(c)a train or tram is on or entering the
crossing; or(d)atrainortramapproachingthecrossingcanbeseenfrom the
crossing or is sounding a warning, and therewould be a
danger of the pedestrian being struck by thetrain or tram if
the pedestrian entered the crossing; or(e)the
crossing, or a road beyond the crossing, is blocked.Example for subsection (2)(e)—Thecrossing,oraroadbeyondthecrossing,maybeblockedbycongested traffic, a disabled vehicle, a
collision between vehicles orbetween a vehicle
and a pedestrian, or by stock on the road.Maximum
penalty—20 penalty units.(2A)Ifanyofthefollowingeventsoccursafterapedestrianhasstartedtocrossarailwayline,ortramtracks,atalevelcrossing, the pedestrian must finish
crossing the line or trackswithout
delay—(a)warninglightsstartflashing,orwarningbellsstartringing;(b)a gate, boom or barrier starts to
close;(c)a train or tram approaches the
crossing.Maximum penalty—20 penalty units.(3)In this section—pedestrian
facilitymeans a footpath, bridge or other
structuredesigned for the use of pedestrians.235ACrossing a pedestrian level crossing
that has a redpedestrian light(1)Apedestrianlevelcrossingisanareawhereafootpathorshared path crosses a railway or tram tracks
at substantiallythe same level.Reprint 2C
effective 30 November 2012Page 231
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
236](2)If a pedestrian approaches a
pedestrian level crossing that hasa red pedestrian
light, the pedestrian must not start to cross thecrossing while the light is red.Maximum penalty—20 penalty units.(3)If a red pedestrian light at a
pedestrian level crossing appearsafterapedestrianhasstartedtocrossthecrossing,thepedestrian must finish crossing the crossing
without delay.Maximum penalty—20 penalty units.Example—Red
pedestrian light showing red pedestrian symbol236Pedestrians not to cause a traffic hazard or
obstruction(1)A pedestrian must not cause a traffic
hazard by moving intothe path of a driver.Maximum penalty—20 penalty units.(2)A pedestrian must not unreasonably
obstruct the path of anydriver or another pedestrian.Maximum penalty—20 penalty units.(3)Forsubsection(2),apedestriandoesnotunreasonablyobstruct the
path of another pedestrian only by travelling moreslowly than other pedestrians.(4)A pedestrian must not stand on, or
move onto, a road—(a)to solicit contributions, employment
or business from anoccupant of a vehicle; orPage
232Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 237](b)to
hitchhike; or(c)to display an advertisement; or(d)to sell things or offer things for
sale; or(e)to wash or clean, or offer to wash or
clean, a vehicle’swindscreen.Maximum
penalty—20 penalty units.(5)A driver, or a
passenger, in or on a vehicle must not buy, oroffer to buy, an
article or service from a person standing onthe road.Maximum penalty—20 penalty units.(6)Subsections(4)(a),(c)and(d)and(5)donotapplytoapedestrian who is engaged in roadside
vending under a permitor other authority given to the person
under a local law.(7)In this section—roadincludes a shoulder of a road, a median
strip, a paintedislandoratrafficisland,butdoesnotincludeanotherroad-related area.237Getting on or into a moving vehicle(1)A person must not get on, or into, a
moving vehicle unless—(a)the person
is—(i)engaged in the door-to-door delivery
or collectionof goods, or in the collection of waste or
garbage;and(ii)required to get
in or out of the vehicle, or on or offthe vehicle, at
frequent intervals; and(b)the vehicle is
not travelling at a speed over 5km/h.Maximum
penalty—20 penalty units.(2)This section
does not apply to a person who is getting on oroff a bicycle or
animal.Reprint 2C effective 30 November 2012Page
233
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
238]238Pedestrians travelling along a road
(except in or on awheeled recreational device or toy)(1)A pedestrian must not travel along a
road if there is a footpathor nature strip
adjacent to the road, unless it is impracticableto
travel on the footpath or nature strip.Maximum
penalty—20 penalty units.(2)A pedestrian
travelling along a road—(a)must keep as far
to the left or right side of the road as ispracticable;
and(ab)must,whenmovingforward,faceapproachingtrafficthatismovinginthedirectionoppositetowhichthepedestrian is travelling, unless it is
impracticable to doso; and(b)must
not travel on the road alongside more than 1 otherpedestrian or vehicle travelling on the road
in the samedirectionasthepedestrian,unlessthepedestrianisovertaking other pedestrians.Maximum penalty—20 penalty units.(3)In this section—pedestriandoesnotincludeapersontravellinginoronawheeled recreational device or wheeled
toy.roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.239Pedestrians on a bicycle path or separated
footpath(1)Apedestrianmustnotbeonabicyclepath,orapartofaseparated
footpath designated for the use of bicycles, unlessthe
pedestrian—(a)is crossing the bicycle path or
separated footpath by theshortest safe route; and(b)does not stay on the bicycle path or
separated footpathforlongerthannecessarytocrossthebicyclepathorseparated footpath safely.Page
234Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 239]Maximum
penalty—20 penalty units.(2)However, a
pedestrian may be on a bicycle path, or a part of aseparated footpath designated for the use of
bicycles, if—(a)the pedestrian is—(i)in
or pushing a wheelchair; or(ii)onrollerblades,rollerskatesorasimilarwheeledrecreational device; and(b)there is no traffic control device, or
information on orwith a traffic control device, applying to
the bicycle pathorseparatedfootpathindicatingthatthepedestrianisnot
permitted to be on the bicycle path or the part of theseparated footpath designated for the use of
bicycles.(3)Apedestrianwhoiscrossingabicyclepath,orapartofaseparatedfootpathdesignatedfortheuseofbicycles,mustkeep
out of the path of any bicycle, or any pedestrian who ispermitted under subsection (2) to be on the
bicycle path, orthepartoftheseparatedfootpathdesignatedfortheuseofbicycles.Maximum
penalty—20 penalty units.(4)In this
regulation—bicyclepathmeansalengthofpathbeginningatabicyclepathsignorbicyclepathroadmarking,andendingatthenearest of the following—(a)anendbicyclepathsignorendbicyclepathroadmarking;(b)aseparatedfootpathsignorseparatedfootpathroadmarking;(c)a road (except a road-related
area);(d)the end of the path.bicycle path road markingmeans a road marking on a path,consisting of a bicycle symbol, the words
‘bicycles only’, orboth the bicycle symbol and the word
‘only’.Reprint 2C effective 30 November 2012Page
235
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
239]endbicyclepathroadmarkingmeansabicyclepathroadmarking with the
word ‘end’.endseparatedfootpathroadmarkingmeansaseparatedfootpath road
marking with the word ‘end’.separated
footpathmeans a length of footpath beginning at
aseparatedfootpathsignorseparatedfootpathroadmarking,and
ending at the nearest of the following—(a)an
end separated footpath sign or end separated footpathroad
marking;(b)a bicycle path sign or bicycle path
road marking;(c)a no bicycles sign or no bicycles road
marking;(d)a road (except a road-related
area);(e)the end of the footpath.separated footpath road markingmeans a road marking on afootpathconsistingofapedestriansymbolandabicyclesymbol side by side, with or without the
word ‘only’.Examples—Bicycle path signPage 236End
bicycle path signReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 240]Separated footpath
signEnd separated footpath signNo
bicycles signDivision 2Rules for
persons travelling in or onwheeled
recreational devices andwheeled toys240Wheeled recreational devices and toys not to
be used oncertain roads(1)Apersonmustnottravelinoronawheeledrecreationaldevice or
wheeled toy on—(a)a road with a dividing line or median
strip; or(b)a road on which the speed limit is
more than 50km/h; or(c)a one-way road
with more than 1 marked lane; or(d)a
road at night.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
237
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
240A](2)Subsection (1) does not apply to a
person who is crossing aroad in or on a wheeled recreational
device or wheeled toy, ifthe person—(a)crosses the road by the shortest safe route;
and(b)does not stay on the road longer than
necessary to crossthe road safely.(3)In
this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.240ANo
wheeled recreational devices or toys signApersononaroadwhoistravellinginoronawheeledrecreational
device or wheeled toy must not travel past a nowheeled
recreational devices or toys sign.Maximum
penalty—20 penalty units.Examples—No
wheeled recreational devices or toys signs241Travelling in or on a wheeled recreational
device or toy ona road(1)A
person travelling in or on a wheeled recreational device orwheeled toy on a road—(a)mustkeepasfartotheleftsideoftheroadasispracticable;
andPage 238Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 242](b)must
not travel alongside more than 1 other pedestrianor
vehicle travelling on the road in the same direction astheperson,unlessthepersonisovertakingotherpedestrians.Maximum
penalty—20 penalty units.(2)In this
section—roaddoes not include
a road-related area, but, in subsection(1)(b), includes
any shoulder of the road.242Travelling in or
on a wheeled recreational device or toy ona footpath or
shared path(1)Subjecttosubsection(1A),apersontravellinginoronawheeled recreational device or wheeled toy
on a footpath orshared path must—(a)keep
to the left of the footpath or shared path unless it isimpracticable to do so; and(b)give way to any pedestrian (except a
person travelling inor on a wheeled recreational device or
wheeled toy) whois on the footpath or shared path.Maximum penalty—20 penalty units.(1A)Subsection (1)
does not apply to a person travelling in or on awheeled recreational device or wheeled toy
on a footpath if alocal law prohibits the travelling.(2)Asharedpathisanareaopentothepublic(exceptaseparated footpath) that is designated for,
or has as 1 of itsmain uses, use by both the riders of
bicycles and pedestrians,andincludesalengthofpathforusebybothbicyclesandpedestriansbeginningatasharedpathsign,orsharedpathroad
marking, and ending at the nearest of the following—(a)anendsharedpathsignorendsharedpathroadmarking;(b)a no bicycles sign or no bicycles road
marking;(c)a bicycle path sign or bicycle path
road marking;Reprint 2C effective 30 November 2012Page
239
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 14 Rules for pedestrians[s
243](d)a road (except a road-related
area);(e)the end of the path.(3)In this section—endsharedpathroadmarkingmeansasharedpathroadmarking that
includes the word ‘end’.shared path road markingmeans a road marking consistingof a
pedestrian symbol above a bicycle symbol.Examples—Shared path signEnd shared path
signNo bicycles signBicycle path
sign243Travelling on rollerblades etc. on a
bicycle path orseparated footpath(1)A
person travelling on rollerblades, rollerskates, or a
similarwheeledrecreationaldevice,mustnotbeonapartofaseparated footpath designated for the
use of pedestrians unlessthe person—Page 240Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 14 Rules for
pedestrians[s 244](a)iscrossingtheseparatedfootpathbytheshortestsaferoute;
and(b)does not stay on the separated
footpath for longer thannecessary to cross the separated
footpath safely.Maximum penalty—20 penalty units.(2)A person travelling on rollerblades,
rollerskates, or a similarwheeled recreational device, on a
bicycle path, or a part of aseparatedfootpathdesignatedfortheuseofbicycles,mustkeep
out of the path of any bicycle.Maximum
penalty—20 penalty units.244Wheeled
recreational devices or wheeled toys beingtowed etc.(1)Apersonmustnottravelinoronawheeledrecreationaldevice or
wheeled toy that is being towed by a vehicle.Maximum
penalty—20 penalty units.(2)A person
travelling in or on a wheeled recreational device orwheeled toy must not hold onto a vehicle
while the vehicle ismoving.Maximum
penalty—20 penalty units.(3)A person
travelling in or on a wheeled recreational device orwheeled toy must not travel within 2m of the
rear of a movingmotor vehicle continuously for more than
200m.Maximum penalty—20 penalty units.244ASection number not used244BWearing of helmets by users of
motorised scooters(1)A person who is travelling on a
motorised scooter on a road orroad-relatedareamustwearanapprovedbicyclehelmetsecurely fitted
and fastened on the person’s head.Maximum
penalty—20 penalty units.Reprint 2C effective 30 November
2012Page 241
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 15 Additional rules for bicycle
riders[s 244C](2)Apersonisexemptfromwearingabicyclehelmetundersubsection(1)ifthepersoniscarryingacurrentdoctor’scertificate stating that, for a stated
period—(a)thepersoncannotwearabicyclehelmetformedicalreasons;
or(b)becauseofaphysicalcharacteristicoftheperson,itwould be unreasonable to require the person
to wear abicycle helmet.244CSection number not usedPart 15Additional rules for bicycleriders245Riding a bicycleThe rider of a
bicycle must—(a)sit astride the rider’s seat facing
forwards (except if thebicycle is not built to be ridden
astride); and(b)ride with at least 1 hand on the
handlebars; and(c)ifthebicycleisequippedwithaseat—notridethebicycle seated in any other position
on the bicycle.Maximum penalty—20 penalty units.246Carrying people on a bicycle(1)Theriderofabicyclemustnotcarrymorepersonsonthebicycle than the bicycle is designed
to carry.Maximum penalty—20 penalty units.Example—A
single-seat bicycle with a child’s seat attached is designed to
carry 2people, 1 on the bicycle seat and 1 on the
attached child’s seat.Page 242Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 15
Additional rules for bicycle riders[s 247](2)A passenger on a bicycle that is
moving, or is stationary butnot parked, must
sit in the seat designed for the passenger.Maximum
penalty—20 penalty units.(3)The rider of a
bicycle must not ride with a passenger unlessthe passenger
complies with subsection (2).Maximum
penalty—20 penalty units.247Riding in a
bicycle lane on a road(1)The rider of a
bicycle riding on a length of road with a bicyclelane
designed for bicycles travelling in the same direction asthe
rider must ride in the bicycle lane unless it is
impracticableto do so.Maximum
penalty—20 penalty units.(2)In this
section—roaddoes not include
a road-related area.247AEntering a bicycle storage areaA
rider of a bicycle approaching a bicycle storage area at anintersection that has traffic lights or
traffic arrows showing ared traffic light or red traffic arrow
must not enter the bicyclestorage area other than from a bicycle
lane, unless the rider isnot required to ride in the bicycle
lane under this regulation.Maximum
penalty—20 penalty units.247BGiving way while
entering or in a bicycle storage area(1)A
rider of a bicycle must when entering a bicycle storage
area,give way to—(a)any
vehicle that is in the area; and(b)if
the area is before any green or yellow traffic lights,any
motor vehicle that is entering or about to enter thearea, unless the motor vehicle is turning in
a directionthat is subject to a red traffic arrow;
andReprint 2C effective 30 November 2012Page
243
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 15 Additional rules for bicycle
riders[s 248](c)if
the area forms part of a lane to which traffic arrowsapply,anymotorvehiclethatisenteringorabouttoenter the area at a time when those arrows
are green oryellow.Maximum
penalty—20 penalty units.(2)Ariderofabicyclethatisinabicyclestorageareathatextends across more than 1 lane of a
multi-lane road must, ifthe area is before any green or yellow
traffic lights, give wayto a motor vehicle that is in any lane
other than the lane thatthe bicycle is directly in front of,
unless the motor vehicle isturning in a
direction that is subject to a red traffic arrow.Maximum penalty—20 penalty units.248No riding across a road on a
crossing(1)The rider of a bicycle must not ride
across a road, or a part ofa road, on a
children’s crossing or a pedestrian crossing.Maximum
penalty—20 penalty units.(2)The rider of a
bicycle must not ride across a road, or a part ofaroad,onamarkedfootcrossing,unlesstherearebicyclecrossinglightsatthecrossingshowingagreenbicyclecrossing light.Maximum
penalty—20 penalty units.249Riding on a
separated footpathThe rider of a bicycle must not ride on a
part of a separatedfootpath designated for the use of
pedestrians.Maximum penalty—20 penalty units.250Riding on a footpath or shared
path(1)Subject to subsection (1A), the rider
of a bicycle riding on afootpath or shared path must—(a)keep to the left of the footpath or
shared path unless it isimpracticable to do so; andPage
244Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 15
Additional rules for bicycle riders[s 251](b)givewaytoanypedestrianonthefootpathorsharedpath.Maximum penalty—20 penalty units.(1A)Subsection (1)
does not apply to a person riding a bicycle on afootpath if a local law otherwise
provides.(2)In this section—footpathdoes
not include a separated footpath.251Riding to the left of oncoming bicycle
riders on a pathTheriderofabicycleridingonabicyclepath,footpath,separated footpath or shared path must keep
to the left of anyoncoming bicycle rider on the path.Maximum penalty—20 penalty units.252No bicycles signs and markings(1)The rider of a bicycle must not ride
on a length of road orfootpathtowhichanobicyclessign,oranobicyclesroadmarking, applies.Maximum
penalty—20 penalty units.(2)A no bicycles
sign, or a no bicycles road marking, applies to alength of road or footpath beginning at the
sign or markingand ending at the nearest of the
following—(a)a bicycle path sign or bicycle path
road marking;(b)a bicycle lane sign;(c)aseparatedfootpathsignorseparatedfootpathroadmarking;(d)a shared path sign;(e)an end no bicycles sign;(f)the next intersection.Reprint 2C effective 30 November 2012Page
245
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 15 Additional rules for bicycle
riders[s 253]Examples—No bicycles signBicycle path
signBicycle lane signSeparated
footpath signShared path signEnd no bicycles
sign253Bicycle riders not to cause a traffic
hazardTheriderofabicyclemustnotcauseatraffichazardbymoving into the path of a driver or
pedestrian.Maximum penalty—20 penalty units.Page
246Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 15
Additional rules for bicycle riders[s 254]254Bicycles being towed etc.(1)A person must not ride on a bicycle
that is being towed byanother vehicle.Maximum
penalty—20 penalty units.(2)Theriderofabicyclemustnotholdontoanothervehiclewhile the vehicle is moving.Maximum penalty—20 penalty units.255Riding too close to the rear of a
motor vehicleThe rider of a bicycle must not ride within
2m of the rear of amoving motor vehicle continuously for more
than 200m.Maximum penalty—20 penalty units.256Bicycle helmets(1)The
rider of a bicycle must wear an approved bicycle helmetsecurely fitted and fastened on the rider’s
head.Maximum penalty—20 penalty units.(2)A passenger on a bicycle that is
moving, or is stationary butnotparked,mustwearanapprovedbicyclehelmetsecurelyfittedandfastenedonthepassenger’shead,unlessthepassenger is a paying passenger on a three-
or four-wheeledbicycle.Maximum
penalty—20 penalty units.(3)The rider of a
bicycle must not ride with a passenger on thebicycle unless
the passenger complies with subsection (2).Maximum
penalty—20 penalty units.(4)Apersonisexemptfromwearingabicyclehelmetundersubsection(1)or(2)ifthepersoniscarryingacurrentdoctor’s
certificate stating that, for a stated period—(a)thepersoncannotwearabicyclehelmetformedicalreasons;
orReprint 2C effective 30 November 2012Page
247
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 15 Additional rules for bicycle
riders[s 257](b)becauseofaphysicalcharacteristicoftheperson,itwould be unreasonable to require the person
to wear abicycle helmet.257Riding with a person on a bicycle
trailer(1)The rider of a bicycle must not tow a
bicycle trailer with aperson in or on the bicycle trailer,
unless—(a)the rider is 16 years old, or older;
and(b)the person in or on the bicycle
trailer is under 10 yearsold; and(c)the
bicycle trailer can safely carry the person; and(d)thepersoninoronthebicycletraileriswearinganapproved bicycle helmet securely fitted and
fastened onthe person’s head.Maximum
penalty—20 penalty units.(1A)Apersonisexemptfromwearingabicyclehelmetifthepersoniscarryingacurrentdoctor’scertificatestatingthat,for a stated
period—(a)thepersoncannotwearabicyclehelmetformedicalreasons;
or(b)becauseofaphysicalcharacteristicoftheperson,itwould be unreasonable to require the person
to wear abicycle helmet.(2)In
this section—bicycle trailermeans a vehicle
that is built to be towed, or istowed, by a
bicycle.258Equipment on a bicycleA
person must not ride a bicycle that does not have—(a)at least 1 effective brake; andPage
248Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 15
Additional rules for bicycle riders[s 259](b)a bell, horn or similar warning device
in working order.Maximum penalty—20 penalty units.259Riding at nightThe rider of a
bicycle must not ride at night, or in hazardousweatherconditionscausingreducedvisibility,unlessthebicycle or device, or the rider,
displays—(a)a flashing or steady white light that
is clearly visible forat least 200m from the front of the
bicycle or device; and(b)a flashing or
steady red light that is clearly visible for atleast 200m from
the rear of the bicycle or device; and(c)aredreflectorthatisclearlyvisibleforatleast50mfromtherearofthebicycleordevicewhenlightisprojected onto it by a vehicle’s headlight
on low-beam.Maximum penalty—20 penalty units.260Stopping for a red bicycle crossing
light(1)The rider of a bicycle approaching or
at bicycle crossing lightsshowing a red bicycle crossing light
must stop before reachingthe bicycle crossing lights.Maximum penalty—20 penalty units.(2)The rider must not proceed
until—(a)the bicycle crossing lights change to
green; or(b)there is no red bicycle crossing light
showing.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
249
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 15 Additional rules for bicycle
riders[s 261]Example—Red bicycle crossing lightGreen
bicycle crossing light261Stopping for a
yellow bicycle crossing light(1)Theriderofabicycleapproachingbicyclecrossinglightsshowing a yellow bicycle crossing light must
comply with thissection.Maximum
penalty—20 penalty units.(2)Iftheridercanstopsafelybeforereachingthebicyclecrossing lights,
the bicycle rider must stop before reaching thelights.(3)If the rider stops before reaching the
bicycle crossing lights,andthelightschangetored,thebicycleridermustnotproceed until—(a)the
bicycle crossing lights change to green; or(b)there is no red or yellow bicycle crossing
light showing.Example—Page
250Yellow bicycle crossing lightReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 15
Additional rules for bicycle riders[s 262]262Proceeding when bicycle crossing
lights change toyellow or red(1)The
rider of a bicycle who is crossing at an intersection, oranotherplaceonaroad,withbicyclecrossinglightsandtraffic lights must comply with this
section.Maximum penalty—20 penalty units.(2)Ifthebicyclecrossinglightschangefromgreentoyellow,flashing yellow,
red or flashing red while the rider is crossingthe road, the
rider must not stay on the road for longer thannecessarytocrosssafelytothenearer(inthedirectionoftravel of the rider) of the
following—(a)adividing strip,
safety zone,ortrafficisland,formingpart of the area
set aside or used by riders of bicycles tocrosstheroadattheintersectionorplace(thesafetyarea);(b)the nearest side
of the road.(3)If, under subsection (2), the rider
crosses to the safety area,theridermustremaininthesafetyareauntilthebicyclecrossing lights
change to green.(4)However,iftheridercannotoperatethebicyclecrossinglights from the safety area, the rider may
cross to the far sideof the road when—(a)the
traffic lights change to green or flashing yellow, orthere is no red traffic light showing;
and(b)it is safe to do so.(5)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Reprint 2C
effective 30 November 2012Page 251
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 16 Rules for persons travelling in
or on vehicles[s 263]Part 16Rules
for persons travelling inor on vehicles263Application of part to persons in or on
tramsThis part, except section 269(1), does not
apply to a person inor on a tram.264Wearing of seatbelts by drivers(1)The driver of a motor vehicle that is
moving, or is stationarybut not parked, must comply with this
section if the driver’sseating position is fitted with a
seatbelt.Maximum penalty—20 penalty units.(2)Thedrivermustweartheseatbeltproperlyadjustedandfastened unless the driver is—(a)reversing the vehicle; or(b)exempt from wearing a seatbelt under
section 267.265Wearing of seatbelts by passengers 16
years old or older(1)A passenger in or on a motor vehicle
that is moving, or that isstationary but not parked, must comply
with subsection (2) ifhe or she—(a)is
16 years old or older; and(b)is not exempt
from wearing a seatbelt under section 267.Maximum
penalty—20 penalty units.(2)The
passenger—(a)mustoccupyaseatingpositionthatisfittedwithaseatbelt; and(b)mustnotoccupythesameseatingpositionasanotherpassenger
(whether or not the other passenger is exemptfrom wearing a
seatbelt under section 267); and(c)must
wear the seatbelt properly adjusted and fastened.Page
252Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 16 Rules for
persons travelling in or on vehicles[s 266](3)Thedriverofamotorvehicle(exceptabusortaxi)thatismoving, or that is stationary but not
parked, must ensure thateachpassengerinoronthevehiclewhois16yearsoldoroldercomplieswithsubsection(2),unlessthepassengerisexempt from wearing a seatbelt under section
267.Maximum penalty—20 penalty units.266Wearing of seatbelts by passengers
under 16 years old(1)The driver of a motor vehicle (except
a bus or motorbike) thatis moving, or is stationary but not
parked, must ensure thatthis section is complied with for each
passenger in or on thevehicle who is under 16 years
old.Maximum penalty—20 penalty units.(2)If the passenger is less than 6 months
old, the passenger mustbe restrained in a suitable and
properly fastened and adjustedrearward facing
approved child restraint.(2A)If the passenger
is 6 months old or older, but is less than 4years old, the
passenger must be restrained in a suitable andproperly
fastened and adjusted—(a)rearward facing
approved child restraint; or(b)forwardfacingapprovedchildrestraintthathasaninbuilt
harness.(2B)If the passenger
is 4 years old or older, but is less than 7 yearsold,
the passenger must—(a)berestrainedinasuitableandproperlyfastenedandadjusted forward facing approved child
restraint that hasan inbuilt harness; or(b)beplacedonaproperlypositionedapprovedboosterseatandberestrainedbyaseatbeltthatisproperlyadjusted and
fastened.(3)A passenger who is under 4 years old
must not be in the frontrow of a motor vehicle that has 2 or
more rows of seats.(3A)Apassengerwhois4yearsoldorolder,butislessthan7years old, must not be in the front row of a
motor vehicle thatReprint 2C effective 30 November 2012Page
253
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 16 Rules for persons travelling in
or on vehicles[s 266]has 2 or more
rows of seats unless all of the other seats in therow
or rows behind the front row are occupied by passengerswho
are also under 7 years old.(4)Ifthepassengeris7yearsoldorolderbutunder16yearsold—(a)the passenger must be restrained in a
suitable approvedchild restraint that is properly adjusted
and fastened; or(b)the passenger—(i)must
occupy a seating position that is fitted with asuitable
seatbelt; and(ii)mustnotoccupythesameseatingpositionasanotherpassenger(whetherornottheotherpassenger is exempt from wearing a seatbelt
undersection 267); and(iii)mustweartheseatbeltproperlyadjustedandfastened.(4A)Subsections(2),(2A),(2B)and(4)donotapplyifthepassengerisexemptfromwearingaseatbeltundersection267.(4AA)It is a defence
to a prosecution of a driver of a motor vehiclefor an offence
against subsection (1) for noncompliance withsubsection (4)
if the driver proves that the offence happened incircumstancesthatmadecompliancewithsubsection(4)unreasonable or impractical.(4AB)However, the
defence is available only if at the time of theoffence—(a)the passenger was occupying a seating
position that isnot fitted with a seatbelt; and(b)thereisnorequirementforthatseatingpositiontobefitted with a seatbelt; and(c)allpassengersinthevehiclewhoareexemptfromwearing a seatbelt are complying with
section 267(8).(4B)Ifapassengercannotsafelyberestrainedasrequiredbysubsection (2) because of the passenger’s
height or weight, thePage 254Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 16 Rules for
persons travelling in or on vehicles[s 266]passenger must be restrained as if
subsection (2A) applied tothe passenger.(4C)Ifapassengercannotsafelyberestrainedasrequiredbysubsection (2A) or (4B) because of the
passenger’s height orweight, the passenger must be
restrained as if subsection (2B)applied to the
passenger.(4D)Ifapassengercannotsafelyberestrainedasrequiredbysubsection (2B) or (4C) because of the
passenger’s height orweight, the passenger must be
restrained as if subsection (4)applied to the
passenger.(4E)In the case of a
passenger sitting in a seating position that isfittedwithalapandsashtypeseatbelt,itissufficientcompliance with
subsection (2B)(b) or (4)(b)(iii), as the casemay be, if,
instead of using the sash part of the seatbelt, anapprovedchildsafetyharnessthatisproperlyadjustedandfastened is used to restrain the upper
body of the passenger.(5)The driver of a
taxi is exempt from subsections (2), (2A) and(2B) in relation
to a passenger if—(a)there is no suitable approved child
restraint available inthe taxi for the passenger; and(b)if the taxi has 2 or more rows of
seats—the passenger isnot in the front row of seats.(6)For this section—(a)anapprovedchildrestraintisavailableinthemotorvehicle for a
passenger if an approved child restraint isfitted in the
vehicle and is not occupied by someone elseunder 16 years
old; and(b)an approved child restraint or
seatbelt is suitable for apassenger if it is suitable for
restraining, or to be wornby the passenger.(6A)For
this section, a child restraint that is properly fastened
andadjusted—(a)isforwardfacingif,onceitrestrainsapassenger,thepassenger’s head is closer to the rear of
the vehicle thanthe passenger’s feet; orReprint 2C
effective 30 November 2012Page 255
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 16 Rules for persons travelling in
or on vehicles[s 266](b)is
rearward facing if, once it restrains a passenger, thepassenger’s feet are closer to the rear of
the vehicle thanthe passenger’s head.(7)In
this section—approved booster seatmeans—(a)a booster seat or cushion that
complies with—(i)AS 1754–1991; or(ii)AS/NZS 1754–1995; or(iii)AS/NZS 1754–2000; or(iv)AS/NZS 1754–2004; or(v)another standard the chief executive
considers is atleast equal to that standard; or(b)a child restraint that—(i)is incorporated in a vehicle;
and(ii)isofthetypementionedintheVehicleStandard(AustralianDesignRule34/01—ChildRestraintAnchoragesandChildRestraintAnchorFittings)2005
(Cwlth), clause 34.8; and(iii)complies with
that clause.approved child restraintmeans a child
restraint that complieswith—(a)AS
1754–1991; or(b)AS/NZS 1754–1995; or(c)AS/NZS 1754–2000; or(d)AS/NZS 1754–2004; or(e)another standard the chief executive
considers is at leastequal to that standard.approved child safety harnessmeans a harness that complieswith—(a)AS
1754–1991; orPage 256Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 16 Rules for
persons travelling in or on vehicles[s 267](b)AS/NZS 1754–1995; or(c)AS/NZS 1754–2000; or(d)AS/NZS 1754–2004; or(e)another standard the chief executive
considers is at leastequal to that standard.267Exemptions from wearing
seatbelts(1)Apassengerwhois4yearsoldorolder,butislessthan7years old, is exempt from complying
with section 266(2B) ifthe passenger is—(a)seated, in a part of the motor vehicle
designed primarilyforthecarriageofgoods,inaseatingpositionthatissuitable for the passenger’s size and
weight; and(b)restrainedbyaseatbeltthatisproperlyadjustedandfastened.(1AA)Forsubsection(1)(a),apartofamotorvehicledesignedprimarily for
the carriage of goods includes a part of a motorvehicle designed primarily for the carriage
of goods on or inwhich a seating position is
installed.(1AB)In the case of a
passenger sitting in a seating position that isfittedwithalapandsashtypeseatbelt,itissufficientcompliance with
subsection (1)(b) if, instead of using the sashpart of the
seatbelt, an approved child safety harness that isproperlyadjustedandfastenedisusedtorestraintheupperbody of the
passenger.(1A)A person in or
on a motor vehicle is exempt from wearing aseatbelt
if—(a)the seating position that the person
occupies is not fittedwith a seatbelt; and(b)thereisnorequirementforthatseatingpositiontobefitted with a seatbelt; and(c)allpassengersinthevehiclewhoareexemptfromwearing a seatbelt are complying with
subsection (8).Reprint 2C effective 30 November 2012Page
257
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 16 Rules for persons travelling in
or on vehicles[s 267](1B)Subsection (1A) does not apply to a person
who is under 16years old.(1C)To
remove any doubt, it is declared that subsection (1A) doesnotauthoriseapassengertowhomsection266(3)or(3A)applies to
occupy a seat in the front row of seats in a vehiclethat
has 2 or more rows of seats.(2)A
person in or on a motor vehicle is exempt from wearing aseatbelt if—(a)thepersonisengagedinthedoor-to-doordeliveryorcollectionofgoods,orinthecollectionofwasteorgarbage, and is required to get in or out of
the vehicle, oron or off the vehicle, at frequent
intervals; and(b)the vehicle is not travelling over
25km/h.(3A)A person is
exempt from wearing a seatbelt if—(a)the
person (or, for a passenger, the driver of the vehicleinwhichthepersonisapassenger)iscarryingacertificate that—(i)is
signed by a doctor; and(ii)states that, in
the opinion of the doctor, the personshouldnotwearaseatbeltduetotheperson’smedical condition; and(iii)displays a date of issue; and(iv)displays an
expiry date that is a date not more than12 months after
the date of issue; and(v)has not expired;
and(b)thepersoniscomplyingwithanyconditionsstatedinthe certificate.(4)However, a person is not exempt under
subsection (3A) if theperson (or, for a passenger, the
driver of the vehicle in whichthe person is a
passenger) does not immediately produce thecertificate
mentioned in the subsection for inspection when apoliceofficeraskstheperson(orthedriver)whethertheperson is exempt from wearing a
seatbelt.Page 258Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 16 Rules for
persons travelling in or on vehicles[s 267](5)A person is exempt from wearing a
seatbelt if—(a)thepersonisapassengerinapoliceoremergencyvehicle;
and(b)either—(i)ifthevehiclehas2ormorerowsofseats—theperson is not in
the front row of seats or there is notaseatingpositionavailableforthepersoninanother row of seats; or(ii)if
the vehicle is a police vehicle and has a caged, orothersecured,areadesignedforthecarriageofpassengers—the person occupies a
seating positionin that area.(6)A
person is exempt from wearing a seatbelt if the person isprovidingorreceivingmedicaltreatmentofanurgentandnecessary nature while in or on a
vehicle.(7)If a truck or bus has a sleeper
compartment, a two-up driver ofthe truck or bus
is exempt from wearing a seatbelt while thetwo-updriveroccupiesthesleepercompartmentforrestpurposes.(8)Ifavehicledoesnothaveseatbeltsorapprovedchildrestraintsfittedtoallitspassengerseatingpositions,apassenger who is exempt from wearing a
seatbelt under thissection must not occupy—(a)a
seating position that is fitted with a seatbelt; or(b)an approved child restraint;if
the result would be that a passenger who is not exempt fromwearingaseatbeltunderthissectionwouldberequiredtooccupy a seating position that is not fitted
with a seatbelt or anapproved child restraint.(8A)A person is
exempt from wearing a seatbelt while the personis driving a
taxi with 1 or more passengers in it.(9)In
this section—two-updriver,foravehiclethatisabusortruck,meansaperson accompanying the vehicle’s
driver on a journey or partReprint 2C
effective 30 November 2012Page 259
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 16 Rules for persons travelling in
or on vehicles[s 268]of a journey,
who has been, is or will be, sharing the task ofdriving the vehicle during the
journey.268How persons must travel in or on a
motor vehicle(1)A person must not travel in or on a
part of a motor vehicle thatis not a part
designed primarily for the carriage of passengersor
goods.Maximum penalty—20 penalty units.(2)A person must not travel in or on a
part of a motor vehicle thatis a part
designed primarily for the carriage of goods unless—(a)the part is enclosed; and(b)the person occupies a seating position
that is suitable forthesizeandweightofthepersonandisfittedwithaseatbelt.Maximum
penalty—20 penalty units.(3)A person must
not travel in or on a motor vehicle with anypartoftheperson’sbodyoutsideawindowordoorofthevehicle, unless the person is the
driver of the vehicle and isgiving a hand
signal—(a)forchangingdirectiontotherightinaccordancewithsection 50; or(b)for
stopping or slowing in accordance with section 55.Maximum penalty—20 penalty units.(4)The driver of a motor vehicle (except
a bus) must not drivewith a passenger if any part of the
passenger’s body is outsidea window or door
of the vehicle.Maximum penalty—20 penalty units.(4A)The driver of a
motor vehicle must not drive with a passengerinoronapartofthevehiclethatisnotapartdesignedprimarily for the carriage of passengers or
goods.Maximum penalty—20 penalty units.Page
260Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 16 Rules for
persons travelling in or on vehicles[s 269](4B)The driver of a
motor vehicle must not drive with a passengerin or on a part
of the vehicle that is a part designed primarilyfor
the carriage of goods unless—(a)the
part is enclosed; and(b)the person
occupies a seating position that is suitable forthesizeandweightofthepersonandisfittedwithaseatbelt.Maximum
penalty—20 penalty units.(5)This section
does not apply to a person who is—(a)in
or on a police or emergency vehicle; or(b)on a
motorbike; or(c)engagedinthedoor-to-doordeliveryorcollectionofgoods, or in the collection of waste or
garbage, in or ona motor vehicle that is not travelling over
25km/h.(6)In this section—enclosed,
for a part of a vehicle—(a)means enclosed
by the structure of the vehicle; but(b)does
not include enclosed by a canopy or cage fitted tothe
vehicle.269Opening doors and getting out of a
vehicle etc.(1)A person must not get off, or out of,
a moving vehicle, unlessthepersonisengagedinthedoor-to-doordeliveryorcollection of goods, or in the
collection of waste or garbage,and the vehicle
is not travelling over 5km/h.Maximum
penalty—20 penalty units.(2)Subsection (1)
does not apply to a person getting off a bicycleor
animal.(3)A person must not cause a hazard to
any person or vehicle byopening a door of a vehicle, leaving a
door of a vehicle open,or getting off, or out of, a
vehicle.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
261
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 16 Rules for persons travelling in
or on vehicles[s 270](4)The
driver of a bus must not drive the bus unless the doors ofthe
bus are closed while the bus is moving.Maximum
penalty—20 penalty units.270Wearing motorbike
helmets(1)The rider of a motorbike that is
moving, or is stationary butnot parked,
must—(a)wear an approved motorbike helmet
securely fitted andfastened on the rider’s head; and(b)not ride with a passenger unless the
passenger complieswith subsection (2).Maximum
penalty—20 penalty units.(2)A passenger on a
motorbike that is moving, or is stationarybutnotparked,mustwearanapprovedmotorbikehelmetsecurely fitted
and fastened on the passenger’s head.Maximum
penalty—20 penalty units.(3)In this
section—approvedmotorbikehelmetmeansahelmetthatcomplieswith—(a)AS 1698–1988; or(b)another standard the chief executive
considers is at leastequal to that standard.passenger, of a
motorbike, includes a person on a passengerseatofthemotorbike,includingthepillionseat,orinasidecar.271Riding on motorbikes(1)Theriderofamotorbikethatismoving(otherthanariderwho is walking
beside and pushing a motorbike), or the riderof a motorbike
that is stationary but not parked, must—(a)sit
astride the rider’s seat facing forwards; andPage 262Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 16 Rules for
persons travelling in or on vehicles[s 271](b)ride with at least 1 hand on the
handlebars; and(c)ifthemotorbikeismoving—keepbothfeetonthefootrests designed for use by the
rider of the motorbike.Maximum penalty—20 penalty
units.(2)A passenger on a motorbike (except a
passenger in a sidecaroronaseat,otherthanapillionseat,designedforapassenger)thatismoving,orisstationarybutnotparked,must—(a)sit astride the pillion seat facing
forwards; and(b)keepbothfeetonthefootrestsdesignedforusebyapillion passenger on the
motorbike.Maximum penalty—20 penalty units.(3)Theriderofamotorbikemustnotridewithapassenger(exceptapassengerinasidecaroronaseat,otherthanapillionseat,designedforapassenger)unlessthepassengercomplies with
subsection (2).Maximum penalty—20 penalty units.(4)Theriderofamotorbikemustnotridewithmorethan1passenger (excluding any passenger in
a sidecar or on a seat,other than a pillion seat, designed
for a passenger).Maximum penalty—20 penalty units.(5)The rider of a motorbike must not ride
with more passengersin a sidecar, or on a seat designed
for a passenger, than thesidecar or seat is designed to
carry.Maximum penalty—20 penalty units.(5A)Theriderofamotorbikemustnotridewithapassenger(exceptapassengerinasidecar)unlessthepassengerisatleast 8 years old.Maximum
penalty—20 penalty units.(5B)A passenger must
not ride in a sidecar of a motorbike unlessthe passenger is
seated safely.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
263
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 17 Additional rules for drivers of
trams, tram recovery vehicles and buses[s 272](5C)The rider of a
motorbike must not ride with a passenger in asidecar unless
the passenger complies with subsection (5B).Maximum
penalty—20 penalty units.272Interfering with
the driver’s control of the vehicle etc.A passenger in
or on a vehicle must not—(a)interfere with
the driver’s control of the vehicle; or(b)obstruct the driver’s view of the road or
traffic.Maximum penalty—20 penalty units.Part
17Additional rules for drivers oftrams, tram recovery vehiclesand
busesDivision 1Trams273Division also applies to tram recovery
vehicles and busestravelling along tram tracks(1)This division applies to the driver of
a tram recovery vehicleas if a reference in the division to a
tram included a referenceto a tram recovery vehicle.(2)Thisdivisionappliestothedriverofabustravellingalongtram
tracks as if a reference in the division to a tram includeda
reference to a bus travelling along tram tracks.274Stopping for a red T lightThe
driver of a tram approaching or at T lights showing a redT
light must stop—Page 264Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 17
Additional rules for drivers of trams, tram recovery vehicles and
buses[s 275](a)if
there is a stop line at or near the T lights—as near aspracticable to, but before reaching, the
stop line; or(b)if there is no stop line at or near
the T lights—as near aspracticable to, but before reaching,
the nearest or only Tlights.Maximum
penalty—20 penalty units.275Stopping for a
yellow T lightThedriverofatramapproachingoratTlightsshowingayellow T light must stop—(a)if there is a stop line at or near the
T lights and the drivercan stop safely before reaching the
stop line—as near aspracticable to, but before reaching,
the stop line; or(b)ifthereisnostoplineat or near the T
lights and thedriver can stop safely before reaching the T
lights—asnear as practicable to, but before reaching,
the nearest oronly T lights.Maximum
penalty—20 penalty units.276Exception to
stopping for a red or yellow T lightThe driver of a
tram approaching or at T lights showing a redor yellow T
light does not have to stop if a white traffic arrowisalsoshowingandthedriveristurninginthedirectionindicated by the
arrow.277Proceeding after stopping for a red or
yellow T lightThe driver of a tram who stops for T lights
showing a red oryellow T light must not proceed
until—(a)a white T light is showing; or(b)no T light is showing and traffic
lights at or near the Tlights are showing a green traffic
light.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
265
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 17 Additional rules for drivers of
trams, tram recovery vehicles and buses[s 278]278Proceeding when a red traffic light
and a white T light orwhite traffic arrow is showing(1)The driver of a tram approaching or at
a white T light at orneartrafficlightsshowingaredtrafficlightmayproceedstraight ahead,
or turn, despite the red traffic light.(2)The
driver of a tram approaching or at a white traffic arrow ator
near traffic lights showing a red traffic light may turn in
thedirection indicated by the arrow, despite
the red traffic light.Example—White
T light279Proceeding when a white T light or
white traffic arrow isno longer showing(1)This
section applies to—(a)thedriverofatramatanintersectionwithTlightsshowing a white
T light who has stopped after the stopline, or nearest
or only T lights, at the intersection; or(b)the
driver of a tram at an intersection with traffic arrowsshowingawhitetrafficarrowwhoisturninginthedirection indicated by the arrow and
has stopped afterthestopline,ornearestoronlytrafficarrows,attheintersection.Example—The driver of a tram may stop after
the stop line at an intersection with Tlights showing a
white T light, and not proceed through the intersection,because the intersection, or a road beyond
the intersection, is blocked bytraffic.Page
266Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 17
Additional rules for drivers of trams, tram recovery vehicles and
buses[s 280](2)If
the T lights or traffic arrows change to yellow or red, or
turnoff, while the driver is stopped and the
driver has not enteredthe intersection, the driver must not
proceed until—(a)a white T light is showing; or(b)there is no T light showing, and
traffic lights at or nearthe T lights are showing a green
traffic light; or(c)if the driver is turning at the
intersection—a white trafficarrowis
showingthatindicatesthe
directioninwhichthe driver is
turning.Maximum penalty—20 penalty units.(3)If the T lights or traffic arrows
change to yellow or red, or turnoff, while the
driver is stopped and the driver has entered theintersection, the driver must leave the
intersection as soon asthe driver can do so safely.Maximum penalty—20 penalty units.Division 2Buses, taxis and
bicycles280Application of division(1)This division applies to any of the
following who is driving ina bus
lane—(a)the driver of a bus;(b)the driver of a taxi;(c)the rider of a bicycle.(2)Thisdivisionappliestothedriverofavehicleotherthanabus,
taxi or bicycle in the same way as it applies to the driverof a
bus, if—(a)thedriverisdrivinginabuslanetowhichBlightsapply;
and(b)thedriverispermittedtodriveinthelaneunderthisregulation.Reprint 2C
effective 30 November 2012Page 267
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 17 Additional rules for drivers of
trams, tram recovery vehicles and buses[s 281]281Stopping for a red B lightThedriverofabusortaxi,ortheriderofabicycle,approaching or
at B lights showing a red B light must stop—(a)if
there is a stop line at or near the B lights—as near aspracticable to, but before reaching, the
stop line; or(b)if there is no stop line at or near
the B lights—as near aspracticable to, but before reaching,
the nearest or only Blights.Maximum
penalty—20 penalty units.282Stopping for a
yellow B lightThedriverofabusortaxi,ortheriderofabicycle,approachingoratBlightsshowingayellowBlightmuststop—(a)if
there is a stop line at or near the B lights and the driveror
rider can stop safely before reaching the stop line—asnear
as practicable to, but before reaching, the stop line;or(b)if there is no
stop line at or near the B lights and thedriverorridercanstopsafelybeforereachingtheBlights—asnearaspracticableto,butbeforereaching,the
nearest or only B lights.Maximum penalty—20 penalty
units.283Exception to stopping for a red or
yellow B lightThedriverofabusortaxi,ortheriderofabicycle,approachingoratBlightsshowingaredoryellowBlightdoes not have to
stop if a white traffic arrow is also showingand the driver
or rider is turning in the direction indicated bythe
arrow.Page 268Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 17
Additional rules for drivers of trams, tram recovery vehicles and
buses[s 284]284Proceeding after stopping for a red or
yellow B lightThe driver of a bus or taxi, or the rider of
a bicycle, who stopsfor B lights showing a red or yellow B
light must not proceeduntil—(a)a
white B light is showing; or(b)no B
light is showing and traffic lights at or near the Blights are showing a green traffic
light.Maximum penalty—20 penalty units.285Proceeding when a red traffic light
and a white B light orwhite traffic arrow is showing(1)Thedriverofabusortaxi,ortheriderofabicycle,approachingoratawhiteBlightatorneartrafficlightsshowing a red
traffic light may proceed straight ahead, or turn,despite the red traffic light.(2)Thedriverofabusortaxi,ortheriderofabicycle,approaching or
at a white traffic arrow at or near traffic lightsshowing a red traffic light may turn in the
direction indicatedby the arrow, despite the red traffic
light.Example—White
B light286Proceeding when a white B light or
white traffic arrow isno longer showing(1)This
section applies to—(a)the driver of a bus or taxi, or the
rider of a bicycle, at anintersection with B lights showing a
white B light whoReprint 2C effective 30 November 2012Page
269
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 17 Additional rules for drivers of
trams, tram recovery vehicles and buses[s 286]hasstoppedafterthestopline,ornearestoronlyBlights, at the intersection; or(b)the driver of a bus or taxi, or the
rider of a bicycle, at anintersection with traffic arrows
showing a white trafficarrow who is turning in the direction
indicated by thearrow and has stopped after the stop line,
or nearest oronly traffic arrows, at the
intersection.Example—The
driver of a bus or taxi, or the rider of a bicycle, may stop after
thestop line at an intersection with B lights
showing a white B light, andnot proceed
through the intersection, because the intersection, or a
roadbeyond the intersection, is blocked by
traffic.(2)If the B lights or traffic arrows
change to yellow or red, orturnoff,whilethedriverorriderisstoppedandhasnotentered the
intersection, the driver or rider must not proceeduntil—(a)a
white B light is showing; or(b)there is no B light showing, and traffic
lights at or nearthe B lights are showing a green traffic
light; or(c)ifthedriverorrideristurningattheintersection—awhitetrafficarrowisshowingthatindicatesthedirection in which the driver or rider is
turning.Maximum penalty—20 penalty units.(3)If the B lights or traffic arrows
change to yellow or red, orturn off, while
the driver or rider is stopped and has enteredthe
intersection, the driver or rider must leave the
intersectionas soon as the driver or rider can do so
safely.Maximum penalty—20 penalty units.Page
270Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 287]Part 18Miscellaneous road rulesDivision 1Miscellaneous rules for drivers287Duties of a driver involved in a
crash(1)This section applies to a driver
involved in a crash.(2)The driver must
stop at the scene of the crash and give thedriver’s
required particulars, within the required time and, ifpracticable, at the scene of the crash,
to—(a)any other driver (or that driver’s
representative) involvedin the crash; and(b)any
other person involved in the crash who is injured, orthe
person’s representative; and(c)theownerofanyproperty(includinganyvehicle)damagedinthecrash(ortheowner’srepresentative),unless, in the
case of damage to a vehicle, the particularsaregiventothedriverofthevehicle(orthedriver’srepresentative).Maximum
penalty—20 penalty units.(3)Thedrivermustalsogivethedriver’srequiredparticulars,within the
required time, to a police officer if—(a)anyone is killed or injured in the crash;
or(b)thedriverdoesnot,foranyreason,givethedriver’srequiredparticularstoeachpersonmentionedinsubsection (2); or(c)the
required particulars for any other driver involved inthe
crash are not given to the driver; or(d)a
motor vehicle involved in the crash is towed or carriedaway
by another vehicle; or(e)property, except
the driver’s motor vehicle, is damagedto the value of
at least the amount fixed for the purposeof section
92(1)(i) of the Act.Reprint 2C effective 30 November
2012Page 271
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
288]Maximum penalty—20 penalty units.(4)The amount fixed for the purpose of
section 92(1)(i) of theAct is $2500.(5)In
this section—requiredparticulars,foradriverinvolvedinacrash,means—(a)the driver’s name and address;
and(b)thenameandaddressoftheownerofthedriver’svehicle;
and(c)the vehicle’s registration number, if
any; and(d)any other information necessary to
identify the vehicle.required time, for a driver
involved in a crash, means as soonas possible but,
except in exceptional circumstances, within24 hours after
the crash.288Driving on a path(1)A
driver (except the rider of a bicycle) must not drive on apath, unless subsection (2) or (3) applies
to the driver.Maximum penalty—20 penalty units.(2)A driver may drive on a path if the
driver is—(a)driving on a part of the path
indicated by information onor with a
traffic control device as a part where vehiclesmay drive;
or(b)drivingonthepathtoenterorleave,bytheshortestpracticableroute,aroad-relatedareaoradjacentlandandthereisnotapartofthepathindicatedbyinformation on or with a traffic control
device as a partwhere vehicles may drive.(3)A driver may drive a motorised
wheelchair on a path if—(a)the unladen mass
of the wheelchair is not over 150kg;and(b)the wheelchair is not travelling over
10km/h; andPage 272Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 289](c)because of the driver’s physical condition,
the driver hasa reasonable need to use a
wheelchair.(4)A driver on a path (except the rider
of a bicycle, or a driverdriving on the path to enter a road
from a road-related area oradjacent land,
or to enter a road-related area or adjacent landfromaroad)mustgivewaytoallotherroadusers,andtoanimals, on the
path.Maximum penalty—20 penalty units.(5)This section does not apply to the
rider of an animal riding theanimal on a
footpath.(6)In this section—pathmeans a bicycle path, footpath or shared
path.289Driving on a nature strip(1)A driver must not drive on a nature
strip adjacent to a lengthof road in a built-up area, unless the
driver is—(a)entering or leaving, by the shortest
practicable route, anarea on the nature strip indicated by
information on orwith a traffic control device as an area
where vehiclesmay drive; or(b)drivingonapartofthenaturestripindicatedbyinformation on or with a traffic control
device as a partwhere vehicles may drive; or(c)drivingonthenaturestriptoenterorleave,bytheshortest practicable route, a
road-related area or adjacentland and there
is not a part of the nature strip indicatedby information
on or with a traffic control device as apart where
vehicles may drive; or(d)riding a bicycle
or animal; or(e)driving a ride-on lawnmower that is
cutting grass on thenature strip; or(f)driving a motorised wheelchair.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
273
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
290](2)Adriverdrivingonanaturestrip(excepttheriderofananimal, or a driver driving on the
nature strip to enter a roadfromaroad-relatedareaoradjacentland,ortoenteraroad-related area or adjacent land
from a road) must give wayto all other road users, and to
animals, on the nature strip.Maximum
penalty—20 penalty units.290Driving on a
traffic islandA driver must not drive on a traffic island
(except the centraltrafficislandinaroundabout),unlessthetrafficislandisdesigned to allow vehicles to be
driven on it.Maximum penalty—20 penalty units.291Making unnecessary noise or
smoke(1)A person must not—(a)start a vehicle, or drive a vehicle, in a
way that makesunnecessary noise or smoke; or(b)wilfully start a vehicle, or drive a
vehicle, in a way thatmakes unnecessary noise or
smoke.Maximum penalty—20 penalty units.Example for paragraph (a)—driving a vehicle in a way that causes
noise or smoke because of—(a)disrepair of the
vehicle; or(b)the way the vehicle is loaded;
or(c)the condition, construction or
adjustment of the vehicle’s engineor other
equipmentExample for paragraph (b)—driving a vehicle in a way that causes
noise or smoke by wilfully andunnecessarily
causing the wheels of the vehicle to lose traction and spinon
the road surfaceNote—An offence
against paragraph (b) is an offence mentioned in thePolicePowers and
Responsibilities Act 2000, section 69A(1)(d).Page
274Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 292](2)A
person must not drive a vehicle to which a noisy instrumentis
attached or on which a noisy instrument is used.Maximum penalty—20 penalty units.(3)Thedriverofavehicleorapassengerinoronthevehiclemust not—(a)ringabellorsoundahorn,exceptahornorsimilarwarning device
under section 224; or(b)play or use a
noisy instrument.Maximum penalty—20 penalty units.292Insecure or overhanging loadAdrivermustnotdriveortowavehicleifthevehicleiscarrying a load that—(a)is not properly secured to the
vehicle; or(b)is placed on the vehicle in a way that
causes the vehicleto be unstable; or(c)projects from the vehicle in a way that is
likely to injureaperson,obstructthepathofotherdriversorpedestrians,ordamageavehicleoranythingelse(forexample, the
road surface).Maximum penalty—20 penalty units.293Removing fallen etc. things from the
road(1)This section applies to a driver
if—(a)something falls onto the road from the
driver’s vehicle,or the driver, or a passenger in or on the
driver’s vehicle,puts something on the road; and(b)there is a possibility that the thing,
if left on the road,may injure a person, obstruct the path
of other drivers orpedestrians,ordamageavehicleoranythingelse(forexample, the
road surface).Reprint 2C effective 30 November 2012Page
275
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
293A](2)The driver must remove the thing, or
take action to have thething removed, from the road as soon
as the driver can do sosafely.Maximum
penalty—20 penalty units.Examples of things—a
fallen load, oil, grease, a wheel chock, debris from an
accident(3)If something has fallen onto the road
from a vehicle becauseofacrashandthevehicleistowedawaybyaperson,theperson must remove the thing from the
road as soon as theperson can do so safely.Maximum
penalty—20 penalty units.(4)In this
section—put, something onto the road,
includes—(a)throw, drop or propel the thing onto
the road; and(b)otherwise cause the thing to be on the
road.293AOil and greaseApersonmustnotdriveavehiclewithouttakingadequateprecautions to stop oil or grease from the
engine or anotherpart of the vehicle dropping onto the
road.Maximum penalty—20 penalty units.293BRestriction on driving or stopping
vehicle on road(1)A person must not drive or stop a
vehicle on a road for thepurposeofsolicitingemploymentorbusinessfromthevehicle, unless the person—(a)is permitted to drive or stop the
vehicle for the primarypurposeofbusinessadvertisingunderapermitissuedunder theTraffic
Regulation 1962, section 126(1)(b); or(b)is
engaged in roadside vending under a permit or otherauthority given to the person under a local
law.Maximum penalty—20 penalty units.Page
276Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 294](2)In
this section—roadincludes a
shoulder of a road, a median strip, a paintedislandoratrafficisland,butdoesnotincludeanotherroad-related area.294Keeping control of a vehicle being
towed(1)Thedriverofamotorvehiclemustnottowanothermotorvehicle
unless—(a)either—(i)the
driver can control the movement of the towedvehicle;
or(ii)the brakes and
steering of the towed vehicle are inworkingorderandapersonwhoislicensedtodrive the towed vehicle is sitting in the
driver’s seatof the towed vehicle, and is in control of
its brakesand steering; and(b)it
is safe to tow the towed vehicle.Maximum
penalty—20 penalty units.(2)The driver of a
motor vehicle must not tow a trailer unless—(a)the
driver can control the movement of the trailer; and(b)it is safe to tow the trailer.Maximum penalty—20 penalty units.(3)The driver of a motor vehicle must not
tow a bicycle, wheeledrecreational device, wheeled toy or
wheelchair.Maximum penalty—20 penalty units.(4)The driver of a motor vehicle must not
tow more than 1 motorvehicle or trailer.Maximum penalty—20 penalty units.(5)However, the driver may tow—(a)morethan1vehicle,ifthemotorvehicleandtowedvehicles combine
to form a B-double or road train; orReprint 2C
effective 30 November 2012Page 277
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
295](b)a car towing trailer with a vehicle
secured to the trailerif—(i)thetrailerhaseffectiveindependentbrakesoroverrun brakes; and(ii)instructions for
securing a vehicle to the trailer areattached to the
trailer.Note—Also, a special
circumstances permit may be issued under theTransportOperations(RoadUseManagement—AccreditationandOtherProvisions)
Regulation 2005, section 106 authorising a person’s use
ofroads in a way prohibited under subsection
(4).(6)In this section—car
towingtrailermeansatrailerwith1axlethatallows avehicle to be
towed by securing the wheels of 1 axle of thevehicle to the
trailer.motor vehicledoes not include
a trailer attached to the motorvehicle.295Motor vehicle towing another vehicle
with a towline(1)The driver of a motor vehicle towing
another vehicle using achain, rope, fabric, strap or wire
(thetowline) must
complywith this section.Maximum
penalty—20 penalty units.(2)If neither of
the vehicles is a motorbike, the driver must keepa
distance of not over 4m between the vehicles.(3)Ifatleast1ofthevehiclesisamotorbike,thedrivermustkeep
a distance of not over 2.5m between the vehicles.(4)If the towline is longer than 2m, the
driver must attach a whiteorbrightlycolouredflag,pieceofclothorothersimilarmaterial (thewarning
material) to the towline in accordancewith
subsection (5).(5)The warning material must—Page
278Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 296](a)besubstantiallysquareorrectangularwith2adjacentsides at least
300mm long; and(b)be attached midway along the towline;
and(c)bevisibleforatleast100mfromeithersideofthewarning
material.(6)Ifthedriveristowingatnight,thedrivermustensurethewarning material is lit by a light attached
to 1 of the vehicles.296Driving a vehicle
in reverse(1)The driver of a vehicle must not
reverse the vehicle unless thedriver can do so
safely.Maximum penalty—20 penalty units.(2)The driver of a vehicle must not
reverse the vehicle furtherthan is
reasonable in the circumstances.Maximum
penalty—20 penalty units.297Driver to have
proper control of a vehicle etc.(1)A
driver must not drive a vehicle unless the driver has propercontrol of the vehicle.Maximum
penalty—20 penalty units.(1A)A driver must
not drive a vehicle if a person or an animal is inthe
driver’s lap.Maximum penalty—20 penalty units.(2)A driver must not drive a motor
vehicle unless the driver has aclear view of
the road, and traffic, ahead, behind and to eachside
of the driver.Maximum penalty—20 penalty units.(3)The rider of a motorbike must not ride
with an animal on thepetrol tank of the motorbike.Maximum penalty—20 penalty units.Reprint 2C effective 30 November 2012Page
279
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
298](4)Subsection (3) does not apply to a
person who rides with ananimal on the petrol tank of a
motorbike for a distance of notmore 500m on a
road for the purposes of a farming activitythat the person
is carrying out.298Driving with a person in a
trailerA driver must not drive a motor vehicle
towing a trailer with aperson in or on the trailer.Maximum penalty—20 penalty units.299Television receivers and visual
display units in motorvehicles(1)A
driver must not drive a motor vehicle that has a televisionreceiver or visual display unit in or on the
vehicle operatingwhile the vehicle is moving, or is
stationary but not parked, ifany part of the
image on the screen—(a)is visible to
the driver from the normal driving position;or(b)is likely to distract another
driver.Maximum penalty—20 penalty units.(2)This section does not apply to the
driver if—(a)the driver is driving a bus and the
visual display unit is,or displays, a destination sign or
other bus sign; or(b)the visual display unit is, or is part
of, a driver’s aid; orExamples of driver’s aids—•closed-circuit
television security cameras•dispatch
system•navigationalorintelligenthighwayandvehiclesystemequipment•rearview screens•ticket-issuing machines•vehicle monitoring devicesPage
280Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 300](ba)the
visual display unit is a mobile data terminal fitted toa
police vehicle or an emergency vehicle.300Use
of mobile phones(1)The driver of a vehicle (except an
emergency vehicle or policevehicle) must
not use a mobile phone that the driver is holdinginthedriver’shandwhilethevehicleismoving,orisstationary but not parked.Maximum penalty—20 penalty units.(2)In this section—mobilephonedoesnotincludeaCBradiooranyothertwo-way
radio.use,inrelationtoamobilephone,includesanyofthefollowing—(a)holdingthephoneto,ornear,theear,whetherornotengaged in a
phone call;(b)writing, sending or reading a text
message on the phone;(c)turning the
phone on or off;(d)operating any other function of the
phone.300ADrinking liquor while drivingThe
driver of a vehicle must not drink liquor while driving thevehicle.Maximum
penalty—20 penalty units.300BBrisbane CBD
driving restrictions(1)This section
applies to a vehicle—(a)withatleast2decksforcarryingvehicles,thatiscarrying a motor vehicle on the upper deck;
orReprint 2C effective 30 November 2012Page
281
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
300C](b)that is carrying a motor vehicle if
more than 500mm ofthelengthofmotorvehicleisabovetheroofofthedriver’s cabin of the carrying
vehicle.(2)ApersonmustnotdrivethevehiclewithintheBrisbaneCBD—(a)between 7a.m. and 6p.m. on a weekday;
or(b)between 7a.m. and midday on a
Saturday.Maximum penalty—20 penalty units.(3)In this section—BrisbaneCBDmeansthenetworkofroads,includingthefollowingroads,inanareaboundedbyanimaginarylinedrawn—•from
the intersection of North Quay and Adelaide St•along Adelaide St to Wharf St•along Wharf St to Eagle St•along Eagle St to Mary St•along Mary St to Felix St•along Felix St to Margaret St•along Margaret St to Edward St•along Edward St to Alice St•along Alice St to William St•along William St to Queen St•along North Quay to Adelaide
St.300CLimitation on use of wheeled
recreational device orwheeled toy(1)Apersonmustnottravelinoronawheeledrecreationaldevice or
wheeled toy if a propellant is attached to it or theperson.Maximum
penalty—20 penalty units.Page 282Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 300D](2)In
this section—propellantmeansamachine(otherthanalever,wheelandaxle,pulley,screw,wedgeorinclinedplane)capableofpropelling a wheeled recreational device or
wheeled toy.300DDriver must not damage rail
infrastructure or obstructlevel crossing(1)Adrivermustnotcausedamagetorailinfrastructureatarailway crossing, unless the driver
has a reasonable excuse.Maximum penalty—80 penalty
units.(2)A driver driving near, on or through a
level crossing must notcauseanobstructiontothepathoftrainsorotherdriversthrough the level crossing, unless the
driver has a reasonableexcuse.Maximum
penalty—80 penalty units.(3)In this
section—damage, to rail
infrastructure, means damage that hinders orprevents the
normal operation or use of the rail infrastructure.railwaycrossingmeansalevelcrossing,bridgeoranotherstructure used
to cross over or under a railway.rail
infrastructuremeans the following—(a)a
warning bell, warning light, gate, boom or barrier;(b)railtransportinfrastructurewithinthemeaningoftheTransport Infrastructure Act
1994.Division 2Rules for people
in charge ofanimals301Leading an animal while driving a
vehicle(1)Thedriverofamotorvehiclemustnotleadananimal,including by
tethering the animal to the motor vehicle.Reprint 2C
effective 30 November 2012Page 283
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
301A]Maximum penalty—20 penalty units.(2)A person who is a passenger in, or on
any part of, a motorvehiclemustnotleadananimalwhilethemotorvehicleismoving.Maximum
penalty—20 penalty units.(3)The rider of a
bicycle must not lead an animal, including bytethering the
animal to the bicycle.Maximum penalty—20 penalty
units.(4)The rider of an animal must not lead
more than 1 other animalon a road, unless the rider holds a
permit issued by a localgovernment.Maximum
penalty—20 penalty units.301AHarnessing an
animal drawing a vehicleThe driver of a vehicle drawn by an
animal must ensure theanimal is harnessed in a way that
enables the driver to—(a)control the
animal; and(b)regulate its speed.Maximum penalty—20 penalty units.301BRiding an animal on a road-related
area when possible(1)A person must not ride or lead an
animal on a road if it ispracticable to ride or lead the animal
on a road-related area.Maximum penalty—20 penalty
units.(2)In this section—roaddoesnotincludearoad-relatedarea,butincludesanyshoulder of the road.Page 284Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 18
Miscellaneous road rules[s 302]302Rider
of an animal on a footpath or nature strip to giveway
to pedestriansThe rider of an animal must give way to any
pedestrian on afootpath or nature strip.Maximum penalty—20 penalty units.303Riding an animal alongside more than 1
other rider(1)The rider of an animal must not ride
on a road alongside morethan1otherrider,unlesstheriderisovertakingtheotherriders or
droving stock.Maximum penalty—20 penalty units.(2)If the rider of an animal is riding on
a road alongside anotherrider, the rider must ride not over
1.5m from the other rider.Maximum penalty—20 penalty
units.(3)In this section—roaddoesnotincludearoad-relatedarea,butincludesabicycle path, shared path and any shoulder
of the road.303AGiving way to restive horses(1)This section applies if a person in
charge of a restive horsegives a signal, by raising a hand and
pointing to the horse, tothe driver of a motor vehicle on a
road.(2)The driver must—(a)drive the vehicle as near as practicable to
the far left sideof the road; and(b)stop
the vehicle’s engine; and(c)notmovethevehicleuntilthereisnoreasonablelikelihood that
the noise of the motor, or the movementofthevehicle,willaggravatetherestivenessofthehorse.Maximum
penalty—20 penalty units.(3)In this
section—Reprint 2C effective 30 November 2012Page
285
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 18 Miscellaneous road rules[s
303B]in charge ofincludes
leading, driving or riding.Division
2ARules for people in charge ofanimal-drawn vehicles303BBrakes(1)Apersoninchargeofananimaldrawingavehiclemustensurethatthevehiclehasanefficientbrakecapableofstopping and holding the vehicle.Maximum penalty—20 penalty units.(2)Fora2-wheeledvehicle,subsection(1)issatisfiedifthevehicle is attached to the animal by a
harness that is suitableand sufficient to enable the vehicle
to be stopped.(3)If the vehicle is a van, lorry, wagon,
or other heavy animaldrawn vehicle, subsection (1) is not
satisfied if the vehicle isequipped only
with a nave brake.Division 3Obeying
directions304Direction by police officer or traffic
controller(1)It is a defence to the prosecution of
a person for an offenceagainstaprovisionofthisregulationif,atthetimeoftheoffence,thepersonwasobeyingadirectiongiventotheperson—(a)byapoliceofficerunderthePolicePowersandResponsibilities Act 2000,
section 59; or(b)byatrafficcontrollercarryingoutthefunctionsofatraffic
controller under theTransport Operations (RoadUse
Management—Accreditation and Other Provisions)Regulation
2005, section 26.(2)In
this section—Page 286Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 19
Exemptions[s 305]traffic
controllermeans a person who holds an
appointmentundertheTransportOperations(RoadUseManagement—AccreditationandOtherProvisions)Regulation2005,part2 asanaccreditedpersonwiththefunction of a traffic controller.Part
19Exemptions305Exemption for drivers of police
vehicles(1)A provision of this regulation does
not apply to the driver of apolice vehicle
if—(a)in the circumstances—(i)the driver is taking reasonable care;
and(ii)it is reasonable
that the provision should not apply;and(b)ifthevehicleisamotorvehiclethatismoving—thevehicleisdisplayingablueorredflashinglightorsounding an alarm.(2)Subsection(1)(b)doesnotapplytothedriverif,inthecircumstances,
it is reasonable—(a)not to display the light or sound the
alarm; or(b)for the vehicle not to be fitted or
equipped with a blue orred flashing light or an alarm.306Exemptions for drivers of emergency
vehiclesA provision of this regulation does not
apply to the driver ofan emergency vehicle if—(a)in the circumstances—(i)the driver is taking reasonable care;
andReprint 2C effective 30 November 2012Page
287
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 19 Exemptions[s 307](ii)it is reasonable
that the provision should not apply;and(b)ifthevehicleisamotorvehiclethatismoving—thevehicle is
displaying a red flashing light or sounding analarm.307Stopping and parking exemption for
police andemergency vehiclesA provision of
part 12 does not apply to the driver of a policevehicle or emergency vehicle if, in the
circumstances—(a)the driver is taking reasonable care;
and(b)it is reasonable that the provision
should not apply.308Exemption for police officers and
emergency workers onfootA provision of
part 14 does not apply to a police officer oremergency worker
acting in the course of the police officer’sor emergency
worker’s duty if, in the circumstances—(a)thepoliceofficeroremergencyworkeristakingreasonable care;
and(b)it is reasonable that the provision
should not apply.309Exemptions for drivers of trams
etc.The following provisions do not apply to the
driver of a tram,the driver of a tram recovery vehicle
engaged in accessing orrecovering a disabled tram, or the
driver of a bus travellingalong tram tracks—•part
4 (Making turns), division 1 (Left turns)•section 88 (Left turn signs)•section 89 (Right turn signs)•section 90 (No turns signs)•section 91 (No left turn and no right
turn signs)Page 288Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 19
Exemptions[s 310]•section 92 (Traffic lane arrows)•section 99 (Keep left and keep right
signs)•section 100 (No entry signs)•part 9 (Roundabouts)•part11(Keepingleft,overtakingandotherdrivingrules), divisions 2 (Keeping to the left), 3
(Overtaking),and 7 (Passing trams and safety
zones)•part 12 (Restrictions on stopping and
parking).310Exemption for road workers etc.(1)A provision mentioned in subsection
(2) does not apply to apersonatthesiteof,andengagedin,roadworksif,inthecircumstances—(a)it
is not practicable for the person to comply with theprovision; and(b)sufficient warning of the roadworks has been
given toother road users.(2)Subsection (1) applies to the following
provisions—•part4(Makingturns),divisions1(Leftturns)and2(Right
turns)•part 7 (Giving way), except——section 67 (Stopping and giving way at
a stop signor stop line at an intersection without
traffic lights)—section 68 (Stopping and giving way at
a stop signor stop line at other places)—section 69 (Giving way at a give way
sign or givewaylineatanintersection,otherthanaroundabout)—section70(Givingwayatagivewaysignatabridge or length of narrow
road)—section 71 (Giving way at a give way
sign or giveway line at other places)Reprint 2C effective 30 November 2012Page
289
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 19 Exemptions[s 310]•part 8 (Traffic signs and road
markings), except——section 102 (Clearance and low
clearance signs)—section 103 (Load limit signs)•part11(Keepingleft,overtakingandotherdrivingrules)•part
12 (Restrictions on stopping and parking)•section 224 (Using horns and similar warning
devices)•part14(Rulesforpedestrians),exceptsection236(1)(which is about causing a traffic hazard by
moving intothe path of an approaching vehicle)•section 264 (Wearing of seatbelts by
drivers)•section265(Wearingofseatbeltsbypassengers16years old or older)•section 268 (How persons must travel in or
on a motorvehicle)•section 288 (Driving on a path)•section 289 (Driving on a nature
strip)•section 290 (Driving on a traffic
island)•section 295 (Motor vehicle towing
another vehicle witha towline)•section 296 (Driving a vehicle in
reverse)•section 297(2) (which requires a
driver to have a clearview of the surrounding road and
traffic)•section 298 (Driving with a person in
a trailer).(3)Section 20 does not apply to a driver
driving a snow-clearingvehicle and engaged in snow
clearing.Editor’s note—section 20 (Obeying the speed limit)(4)In this section—Page 290Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 19
Exemptions[s 311]road transport
infrastructurehas the meaning given by theTransport Infrastructure Act 1994.roadworksmeans—(a)construction or maintenance of a road
or road transportinfrastructure; or(b)road
cleaning; or(c)installationormaintenanceofatrafficcontroldevice,traffic-related
item or traffic monitoring device; or(d)a
road surface survey test.311Exemption for
oversize vehicles(1)A provision mentioned in subsection
(2) does not apply to thedriverofanoversizevehicle,orthedriverofavehicleescorting or piloting an oversize vehicle,
if—(a)itisnotpracticableforthedrivertocomplywiththeprovision; and(b)the
driver is taking reasonable care; and(c)thedriveriscomplyingwithanyguidelineorpermitapplyinginrelationtothemovementoftheoversizevehicleundertheTransportOperations(RoadUseManagement—Mass,DimensionsandLoading)Regulation
2005; and(d)the
vehicle is displaying an oversize warning sign.(2)For
subsection (1), the provisions are as follows—•part
7 (Giving way), except——section 67
(Stopping and giving way at a stop signor stop line at
an intersection without traffic lights)—section 68 (Stopping and giving way at a
stop signor stop line at other places)—section 69 (Giving way at a give way
sign or givewaylineatanintersection,otherthanaroundabout)Reprint 2C
effective 30 November 2012Page 291
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 19 Exemptions[s 312]—section70(Givingwayatagivewaysignatabridge or length of narrow
road)—section 71 (Giving way at a give way
sign or giveway line at other places)•part 8 (Traffic signs and road
markings), except——section 102 (Clearance and low
clearance signs)—section 103 (Load limit signs)•section111(3)(whichisaboutenteringaroundaboutfrom the right
marked lane or line of traffic)•section 116 (Obeying traffic lane arrows
when driving inor leaving a roundabout)•part11(Keepingleft,overtakingandotherdrivingrules)•part
12 (Restrictions on stopping and parking)•section 268 (How persons must travel in or
on a motorvehicle)•section 288 (Driving on a path)•section 289 (Driving on a nature
strip)•section 290 (Driving on a traffic
island)•section 296 (Driving a vehicle in
reverse)•section 297(2) (which requires a
driver to have a clearview of the surrounding road and
traffic).312Exemption for tow truck drivers(1)It is a defence to the prosecution of
the driver of a tow truckfor an offence against a provision
mentioned in subsection (2)if, at the time
of the offence—(a)thedriverisengagedinloading,orconnectingto,avehicle to which this section applies;
and(b)the driver is unable to comply with
the provision; and(c)the tow truck is displaying a flashing
light; andPage 292Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 19
Exemptions[s 313](d)the
driver is acting safely.(2)For subsection
(1), the provisions are as follows—•part
4 (Making turns)•part 6 (Traffic lights, traffic arrows
and twin red lights)•part 7 (Giving
way), division 1 (Giving way at a stopsign, stop line,
give way sign or give way line applyingto the
driver)•part 8 (Traffic signs and road
markings)•part 9 (Roundabouts)•part11(Keepingleft,overtakingandotherdrivingrules)•part
12 (Restrictions on stopping and parking)•section 288 (Driving on a path)•section 289 (Driving on a nature
strip)•section 290 (Driving on a traffic
island).(3)This section applies to the following
vehicles—(a)a vehicle at the scene of a
crash;(b)a disabled vehicle;(c)a vehicle unsafely or unlawfully
parked that the driver isauthorised to tow away under the
Act.313Exemption for postal vehicles(1)A provision mentioned in subsection
(2) does not apply to thedriver of a postal vehicle.(2)Subsection (1) applies to the
following provisions—•section 179
(Stopping in a loading zone)•section 180 (Stopping in a truck
zone)•section 182 (Stopping in a taxi
zone)•section 185 (Stopping in a permit
zone)Reprint 2C effective 30 November 2012Page
293
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 19 Exemptions[s 313A]•section 186 (Stopping in a mail
zone)•section 189 (Double parking)•section 198 (Obstructing access to and
from a footpath,driveway etc.).(3)Sections 288 and 289 do not apply to the
driver of a postalvehicle if—(a)the
postal vehicle is a motorbike with an engine capacityof
125mL or less; and(b)the driver is driving the motorbike at
a speed of 10km/hor less; and(c)the
driver drives in a way that does not cause danger to,orobstruct,anyoneoranythingonthepathornaturestrip;
and(d)the driver takes reasonable
precautions to avoid crashingwith anyone or
anything on the path or nature strip.Editor’s
note—sections 288 (Driving on a path) and
289 (Driving on a nature strip)313AExemption for garbage truck drivers
etc.(1)A provision mentioned in subsection
(2) does not apply to thedriver of a garbage truck, a waste
disposal truck or a vehicledesigned for
collecting goods for recycling if—(a)the
driver is engaged in the collection of garbage, wasteor
goods for recycling; and(b)itisnotpracticableforthedrivertocomplywiththeprovision; and(c)the
truck or vehicle is displaying a flashing light; and(d)the driver is acting safely.(2)For subsection (1), the provisions are
as follows—•section 98 (One-way signs)•section 99 (Keep left and keep right
signs)Page 294Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 19
Exemptions[s 313B]•section 100 (No entry signs)•part 12 (Restrictions on stopping and
parking), except——section 175 (Stopping on or near a
level crossing)—section 177 (Stopping on a
freeway)—section178(Stoppinginanemergencystoppinglane)—section192(Stoppingonabridgeorinatunneletc.)—section 196 (Stopping at or near a tram
stop)—section197(Stoppingonapath,dividingstrip,nature strip or
painted island)•section 228 (No pedestrian
signs)•section 230 (Crossing a
road—general)•section 234 (Crossing a road on or
near a crossing forpedestrians)•section 238 (Pedestrians travelling along a
road (exceptin or on a wheeled recreational device or
toy)).313BExemption for breakdown
vehicles(1)A provision mentioned in subsection
(2) does not apply to thedriver of a breakdown vehicle
while—(a)the driver is engaged in repairing a
disabled vehicle; and(b)the driver is
unable to comply with the provision; and(c)the
breakdown vehicle is displaying a flashing light; and(d)the driver is acting safely.(2)For subsection (1), the provisions are
as follows—•section 137 (Keeping off a dividing
strip)•section 138 (Keeping off a painted
island)Reprint 2C effective 30 November 2012Page
295
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 314]•section147(Movingfrom1markedlanetoanothermarkedlaneacrossacontinuouslineseparatingthelanes)•section 289 (Driving on a nature
strip)•section 290 (Driving on a traffic
island).(3)In this section—breakdown
vehiclemeans any vehicle driven by a person
whois—(a)a breakdown
worker; and(b)driving the vehicle in the course of
performing duties asa breakdown worker.breakdownworkermeansapersonwhoattendsdisabledvehicles as part of the person’s employment
for the purpose ofrepairing the disabled vehicle.Part
20Traffic control devices andtraffic-related itemsDivision 1General314Diagrams of traffic control devices,
traffic-related itemsand symbols(1)Adiagraminthisregulationofatrafficcontroldevice,traffic-relateditem,orsymbolrepresentsalikenessofthedevice, item or symbol.(2)If there are 2 or more diagrams of a
traffic sign in schedules 2and 3 or of a
traffic-related item or symbol in schedule 4, eachdiagramrepresentsalikenessofapermittedversionofthesign, item or
symbol.Page 296Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 315](3)Ifadiagramofatrafficsigninschedule2or3orofatraffic-relateditemorsymbol inschedule4isinblackandwhite, the permitted version of the sign,
item or symbol is inblack and white only.(4)If a diagram of a traffic sign,
traffic-related item or symbol ina section of
this regulation is in black and white and the sign,item
or symbol is not in black and white only in schedule 2, 3or
4, the diagram is a black and white representation of thesign, item or symbol and is not a permitted
version of the sign,item or symbol.315Legal
effect of traffic control devices(1)A
traffic control device of a kind mentioned in this
regulationhas effect for this regulation if—(a)the device is on a road; and(b)the device complies substantially with
this regulation.(2)A traffic control device is taken to
comply substantially withthis regulation unless the contrary is
proved.316When do traffic control devices comply
substantially withthis regulation(1)A
traffic sign complies substantially with this regulation if—(a)it is a reasonable likeness of a
diagram in schedule 2 or3 of that kind of traffic sign;
or(b)foratrafficsignofakindforwhichthereisnotadiagraminschedule2or3—itcompliessubstantiallywithadescriptionofthatkindoftrafficsigninthisregulation and,
if the description includes a symbol forwhich there is a
diagram in schedule 4, the symbol onthe sign is a
reasonable likeness of the diagram.(2)A
road marking complies substantially with this regulation ifitcompliessubstantiallywithadescriptionofthatkindofroad marking in this regulation and,
if the description includesasymbolforwhichthereisadiagraminschedule4,theReprint 2C effective 30 November
2012Page 297
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 316]symbolintheroadmarkingisareasonablelikenessofthediagram.(3)Atrafficcontroldevice(exceptatrafficsignoraroadmarking)compliessubstantiallywiththisregulationifthedevice complies substantially with a
description of that kindoftrafficcontroldeviceinthisregulationand,ifthedescription
includes a symbol for which there is a diagram inschedule 4, the symbol on the device is a
reasonable likenessof the diagram.(4)A
traffic sign may be a reasonable likeness of a diagram of akindoftrafficsignmentionedinthisregulationeventhough—(a)the
dimensions of the sign, or of anything on the sign,are
different; or(b)the sign has additional information on
or with it; or(c)the number on the sign is different;
or(d)the sign has a different number of
panels; or(e)the sign is combined on a single panel
with 1 or moreother traffic signs; or(f)for
a parking control sign—words, figures, symbols, oranything else, on the sign are differently
arranged; or(g)for a bus lane sign, emergency
stopping lane only sign,one-way sign or parking control
sign—the sign has anarrow pointing in a different
direction; or(h)foraseparatedfootpathsignoranendseparatedfootpath sign—the pedestrian and bicycle
symbols arereversed; or(i)for
a road access sign—information on or with the signindicates(whetherbydifferentwordingorinanotherway)
that it applies to different or additional vehicles orpersons; or(j)thereisavariationinshadeorbrightnessbetweenacolouronthesignandtheequivalentcolourinthediagram.Page
298Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 316]Example for subsection (4)(b)—A speed limit sign near a school may
say that the sign has effect atcertaintimes.Thisadditionalinformationdoesnotpreventthesignbeing a reasonable likeness of the
diagram of a speed limit sign inschedule
2.Example for subsection (4)(c)—The diagram of the area speed limit
sign in schedule 2 has the number‘60’. A
particular area speed limit sign may have another number,
forexample, ‘50’. The different number on the
sign does not prevent thesign being a reasonable likeness of
the diagram.Examples for subsection (4)(d)—1A school zone
sign may have the indicated speed limit, the words‘school zone’, and the times of operation,
on a single panel orseparate panels.2An
end bicycle path sign may have the word ‘end’ on a separatepanel
or on the same panel as the rest of the sign.Example for
subsection (4)(e)—A no parking sign that operates at
certain times may be combined on asingle panel with
a permissive parking sign allowing pay parking atother
times.Example for subsection (4)(f)—A permissive parking sign limiting
parking to 2 hours may have the timelimit above, or
below, the word ‘parking’.Example for subsection (4)(i)—The diagram of the road access sign in
schedule 2 says ‘no pedestriansbicyclesanimalsbeyondthispoint’.Thereplacementoftheword‘bicycles’ by the
word ‘tractors’ on a particular sign does not prevent thesign
being a reasonable likeness of the diagram.(5)A
variable illuminated message sign may also be a reasonablelikeness of a diagram of a kind of traffic
sign in schedule 2 or3 even though the colour of the sign,
or of anything else on thesign, is different.Reprint 2C effective 30 November 2012Page
299
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 317]Example of
standard sign and variable illuminated message sign—Speed limit sign (Standard sign)Speed
limit sign (Variable illuminatedmessage
sign)(6)A symbol on or in a traffic control
device may be a reasonablelikeness of a diagram of a kind of
symbol mentioned in thisregulation even though the dimensions
of the symbol, or ofanything on the symbol, are
different.(7)In this section—panelincludes a board, plate and screen.317Information on or with traffic control
devices(1)Atrafficcontroldevicemay,bytheuseofwords,figures,symbols or anything else indicate any of the
following—(a)the times, days or circumstances when
it applies or doesnot apply;(b)the
lengths of road or areas where it applies or does notapply;(c)the
persons to whom it applies or does not apply;(d)the
vehicles to which it applies or does not apply;(e)other information.Examples of
circumstances—1A speed limit
sign may indicate that it applies when the lights at achildren’s crossing are flashing.2A speed limit sign may indicate that
it applies when children arepresent.Page
300Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 318](2)In this section—traffic control
deviceincludes a board, device, plate,
screen,word, figure, symbol, or anything else, with
a traffic controldevice that provides information about the
application of thetraffic control device.Examples of
information with a traffic control device—•a plate erected immediately below a no
U-turn sign indicating thatthe sign applies on Monday to Friday
between 8a.m. and 6p.m.•an illuminated
board erected close to, but not next to, a no entrysign
indicating that commercial trucks are permitted to pass thesign
when the words on the board are illuminated318Limited effect of certain traffic control
devices(1)Ifinformationonatrafficcontroldeviceindicatesthatthedevice applies during particular times, on
particular days, inparticular circumstances, to a particular
length of road or area,or to particular persons or vehicles,
the device has effect onlyfor the indicated times, days,
circumstances, length of road,area, persons or
vehicles.Example—a
shared zone sign on a road into an area indicating that the sign
applieson Monday to Friday between 7a.m. and
6p.m.(2)Ifinformationonatrafficcontroldeviceindicatesthatthedevicedoesnotapplyduringparticulartimes,onparticulardays, in
particular circumstances, to a particular length of roador
area, or to particular persons or vehicles, the device doesnot
have effect for the indicated times, days, circumstances,length of road, area, persons or
vehicles.Examples—•aplateerectednexttoapedestriancrossingsignataplaceindicating that the sign does not apply on a
particular day•aboarderectedclosetoabuslanesignaboveamarkedlaneindicating that the sign does not apply when
the words on the boardare illuminated(3)Ifinformationonatrafficcontroldevicethatisataplaceindicates that
it applies on a particular day of the week, theReprint 2C
effective 30 November 2012Page 301
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 319]device does not
have effect on a day that is a public holidayfortheplaceunlessinformationonthedevicestatesotherwise.Example—If a loading zone sign indicates that
it applies on Monday to Fridaybetween 9a.m. and
4p.m. and information on or with the sign does notindicate that it applies on public holidays,
the sign does not have effecton any public
holiday falling on a Monday to Friday.(4)In
this section—traffic control deviceincludes a
board, device, plate, screen,word, figure,
symbol, or anything else, with a traffic controldevice that provides information about the
application of thetraffic control device.319Legal
effect of traffic-related items mentioned in thisregulation(1)A
traffic-related item of a kind mentioned in this regulationhas
effect for this regulation if—(a)the
item is on a road or on a vehicle on a road; and(b)the item complies substantially with
this regulation.(2)A traffic-related item is taken to
comply with this regulationunless the
contrary is proved.320When do traffic-related items comply
substantially withthis regulation(1)Atraffic-relateditemcompliessubstantiallywiththisregulation
if—(a)it is a reasonable likeness of a
diagram in schedule 4 ofthat kind of traffic-related item;
or(b)for a traffic-related item of a kind
for which there is nota diagram in schedule 4—(i)it complies substantially with a
description of thatkind of traffic-related item in this
regulation; andPage 302Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 321](ii)if the
description includes a symbol for which thereis a diagram in
schedule 4, the symbol on the itemis a reasonable
likeness of the diagram.(2)Atraffic-relateditemmaybeareasonablelikenessofadiagramofakindoftraffic-relateditemmentionedinthisregulation even
though—(a)the dimensions of the item or of
anything on the item aredifferent; or(b)the
item has additional information.(3)Asymbolonatraffic-relateditemmaybeareasonablelikeness of a
diagram of a kind of symbol mentioned in thisregulationeventhoughthedimensionsofthesymbolorofanything on the symbol are
different.321Meaning of information on or with
traffic control devicesand traffic-related itemsAword,figure,symboloranythingelseusedonorwithatrafficcontroldeviceortraffic-relateditemhasthesamemeaning as in this regulation.322Reference to traffic control devices
and traffic-relateditems on a road etc.(1)A
traffic control device or traffic-related item above or near
aroad is taken to be on the road.Examples—1A speed limit sign erected on a post
at the side of a road is taken tobe a speed limit
sign on the road.2A traffic lane arrow on a structure
immediately above the road istaken to be a
traffic lane arrow on the road.3A do
not overtake turning vehicle sign attached to a vehicle on aroad
is taken to be a do not overtake turning vehicle sign on theroad.(2)However, the device or item is taken to be
on the road only ifitisclearlyvisibletoroaduserstowhomitisdesignedtoapply.Reprint 2C
effective 30 November 2012Page 303
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 322]Example—A shared zone sign erected on a post
near the side of a road is a trafficsign on the road
only if it is clearly visible to drivers driving on the roadduring the day and in normal weather
conditions.(3)A traffic control device or
traffic-related item above or nearan area or place
is taken to be in or at the area or place.Examples—1Traffic lights
erected outside the area of an intersection, but nearthat
area, are taken to be traffic lights at the intersection.2A hook turn only sign fixed to a
structure above a road that is closeto, but before,
an intersection is taken to be a hook turn only sign atthe
intersection.3A parking control sign near the side
of a road is taken to be at theside of the
road.4A parking control sign near the centre
of a road is taken to be at thecentre of the
road.(4)However, the device or item is taken
to be in or at the area orplace only if it is clearly visible to
road users to whom it isdesigned to apply.Example—A no right turn sign suspended from
wires above a road close to, butbefore, an
intersection is a traffic sign at the intersection only if it
isclearly visible to drivers approaching the
intersection during the day andin normal weather
conditions.(5)Withoutlimitingsubsection(3),atrafficcontroldeviceortraffic-related item above or near a break
in a dividing strip istaken to be at the break.Example—A no
U-turn sign erected in a dividing strip close to, but before, a
breakin the dividing strip is taken to be at the
break.(6)However, the device or item is taken
to be at the break only ifitisclearlyvisibletoroaduserstowhomitisdesignedtoapply.(7)Atrafficcontroldeviceortraffic-relateditemistakentocomply with subsection (2), (4) or (6)
unless the contrary isproved.Page 304Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 323](8)In this section—clearly
visiblemeans—(a)for
a traffic signal—clearly visible during the day andnight in normal weather conditions;
or(b)foranothertrafficcontroldeviceoratraffic-relateditem—clearly
visible during the day in normal weatherconditions.daymeans the period between sunrise on a day
and sunset onthe same day.normal weather
conditionsmeans weather conditions that arenot
hazardous weather conditions causing reduced visibility.323References to lights that are traffic
signalsA reference in this regulation to a light
that is, or is part of,traffic signals is a reference to a
steady light, unless otherwiseexpressly
stated.323AAudible lines(1)An
audible line is a line on a road that is made up of a seriesof
closely spaced raised pieces of material designed to create
acontinuous noise or vibration if driven on
by a motor vehicle.(2)A reference in this regulation to a
line is to be taken to includeareferencetoanaudibleline,unlessotherwiseexpresslystated.(3)For the purposes of this
regulation—(a)an audible line is taken to be
continuous even if there isno physical link
between the pieces of material makingup the line;
and(b)ifthereisnophysicallinkbetweenthosepieces,thecolouroftheaudiblelineistakentobethevisiblecolour of those pieces.Reprint 2C
effective 30 November 2012Page 305
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 324]Division 2Application of traffic controldevices to lengths of roads andareas324Purpose of division(1)Thisdivisioncontainsrulesexplainingwhentrafficcontroldevices apply to lengths of road and
areas.(2)Other relevant rules are found
elsewhere in this regulation.325References to traffic control
devices—application tolengths of road and areasInapplyingthisregulationtoalengthofroadoranarea,unless the
contrary intention appears, a reference to a trafficcontroldeviceisareferencetoatrafficcontroldeviceapplying to the length of road or
area.326When do traffic control devices apply
to a length of roador area—the basic rules(1)A
traffic control device applies to a length of road or an
areaif—(a)the device
applies to the length of road or area under 1or more
provisions of this regulation; or(b)the
device, the position of the device, or information onor
with the device indicates that the device applies to thelength of road or area.(2)A
traffic control device does not apply to a length of road oranareaifinformationonorwiththedeviceexpresslyindicates that it does not apply to the
length of road or area.(3)Subsection(2)appliesdespiteanyotherprovisionofthisdivision.(4)In subsection (1)(b)—the
deviceincludes another traffic control
device.Page 306Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 327]327Length of road to which a traffic sign
(except a parkingcontrol sign) appliesThe length of
road to which a traffic sign on a road (except aparkingcontrolsign)appliesisworkedoutinthedirectiondriven by a driver, or travelled by a
pedestrian, on the roadwho faces the sign before passing
it.Example—Section 21(2) provides that a speed limit
sign applies to the length ofroad beginning at
the sign and ending at the nearest of a different speedlimit
sign, an end speed limit sign or speed derestriction sign, or the
endof the road. Only the nearest of those
things, in the direction driven by adriver, or
travelled by a pedestrian, who faces the sign before passing
it,is relevant.328References to a traffic control device
applying to a lengthof roadIf,underthisregulation,atrafficcontroldeviceonaroadapplies to a
length of road, the device applies only to a lengthof
road on that road, unless otherwise expressly stated.Example—A
speed limit sign on a road does not apply to roads leading off from
theroad.329Traffic control devices applying to a marked
lane(1)A traffic control device (except a
road marking) applies to amarked lane if—(a)it
is above the marked lane; or(b)it
is near the marked lane and the device, the position ofthedevice,orinformationonorwiththedeviceindicates that
it applies to the marked lane.Example—Anemergencystoppinglaneonlysignappliestothemarkedlaneindicated by the arrow on the
sign.(2)A road marking applies to a marked
lane if it is on the surfaceof the
lane.Reprint 2C effective 30 November 2012Page
307
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 330](3)However, a traffic control device does not
apply to a markedlane if information on or with the device
expressly indicatesthat the device does not apply to the marked
lane.(4)In subsection (1)(b)—the
deviceincludes another traffic control
device.330Traffic control devices applying to a
slip lane(1)A traffic control device (except a
road marking) applies to aslip lane if—(a)it
is above the slip lane; or(b)it is near the
slip lane and on the left side of the slip lane;or(c)it is near the
slip lane and the device, the position of thedevice,orinformationonorwiththedeviceindicatesthat
it applies to the slip lane.(2)A
road marking applies to a slip lane if it is on the surface
ofthe slip lane.(3)However, a traffic control device does not
apply to a slip laneif information on or with the device
expressly indicates thatthe device does not apply to the slip
lane.(4)In subsection (1)(c)—the
deviceincludes another traffic control
device.331Traffic control devices applying to an
intersectionA traffic control device—(a)applies to an intersection if it is at
the intersection; and(b)does not apply
to a slip lane at the intersection, unlessinformationonorwiththedeviceexpresslyindicatesthat the device
does not apply to the intersection.Page 308Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 332]332Parking control signs applying to a
length of road(1)If a parking control sign displays an
arrow and is at the side ofa road, then,
unless information on or with the sign indicatesotherwise, the sign applies to the length of
road between thesign and the nearest (in the direction
indicated by the arrow)of the following—(a)aparkingcontrolsignatthatsideoftheroadthatdisplays an
arrow indicating the opposite direction;(b)a
yellow edge line on the road;(c)if
the road ends at a T-intersection or dead end—the endof
the road.(2)If a parking control sign displays an
arrow and is at the centreof a road or on a dividing strip,
then, unless information on orwiththesignindicatesotherwise,thesignappliestothelengthofroadbetweenthesignandthenearest(inthedirection indicated by the arrow) of
the following—(a)aparkingcontrolsignatthatsideoftheroadthatdisplays an
arrow indicating the opposite direction;(b)a
yellow edge line on the road;(c)if
the road ends at a T-intersection or dead end—the endof
the road.333Parking control signs applying to a
length of road in anarea to which another parking control sign
applies etc.(1)If a parking control sign applying to
a length of road is in anareatowhichanotherparkingcontrolsignappliesinaccordancewithsection335,thefirstparkingcontrolsignapplies in the same way as it would apply if
it were not in thatarea, and the second parking control sign
does not apply to thelength of road.Example—Parking control signs that establish a
loading zone or taxi zone mayoperateonalengthofroadinanareawhereparkingisotherwiserestricted to
residents only by other parking control signs on each roadinto
the area.Reprint 2C effective 30 November 2012Page
309
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 334](2)If
the area indicated by a people with disabilities road
markingisinanareatowhichaparkingcontrolsignappliesinaccordance with section 335, the road
marking applies in thesame way as it would apply if it were
not in that area, and theparking control sign does not apply to
the area indicated bythe road marking.334How
parking control signs apply to a length of road(1)If a
permissive parking sign, bicycle parking sign, motorbikeparking sign, or a parking control sign for
a zone mentioned inpart 12, division 5, applies to a length of
road and there areparking bays on the length of road, the sign
applies only to theparking bays, unless information on or with
the sign indicatesotherwise.(2)If a
parking control sign applies to a length of road, the sign
isat the side of the road, and there are no
parking bays to whichthe sign applies, then, unless
information on or with the signindicates
otherwise, the sign applies to—(a)any
shoulder of the road on that side of the road; and(b)the part of the road on the length of
road extending fromthe far side of the road (excluding any
road-related area)on that side of the road for—(i)ifthesign,orinformationonorwiththesign,includesthewords‘angleparking’or‘angle’—6metres;
or(ii)in any other
case—3 metres.Page 310Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 335]Examples—Example 1Example 2Part
of a road to which a parking controlPart of a road to
which a parking controlsign indicating angle parking
appliessign (except a sign indicating angleparking) applies(3)If a
parking control sign applies to a length of road, the sign
isat the centre of the road or on a dividing
strip, and there are noparkingbaystowhichthesignapplies,then,unlessinformation on or with the sign indicates
otherwise, the signapplies to—(a)ifthesignisatthecentreoftheroad,butnotonadividingstrip—thepartoftheroadonthatlengthofroad extending 3m from the centre of
the road on eachside of the road; or(b)if
the sign is on a dividing strip—the dividing strip onthat
length of road and the part of the road on that lengthofroadextending3mfromeachedgeofthedividingstrip.335Traffic control devices applying to an
area(1)A traffic control device (except a
road marking) applies to anarea if—(a)it is in the area; andReprint 2C effective 30 November 2012Page
311
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 335](b)the
device, the position of the device, or information onor
with the device indicates that the device applies to thearea.(2)A
traffic control device (except a road marking) also appliesto
an area if—(a)there is an identical kind of traffic
control device (thefirst traffic control device) on
each road into the area;and(b)thetrafficcontroldeviceisatrafficcontroldeviceapplying to an
area, or information on or with the deviceindicates that
it applies to an area; and(c)information on
or with a traffic control device on eachroad out of the
area indicates that the first traffic controldevice no longer
applies or that the area has ended.Examples of
traffic control devices applying to an area—•a shared zone sign•a no
stopping sign or no parking sign with the word ‘area’•a permissive parking sign with the
words ‘parking area’•an end no parking area sign•an end no stopping area sign•an end parking area sign(3)A road marking applies to an area
if—(a)it is on the surface of the area;
and(b)the road marking, the position of the
road marking, orinformation in or with the road marking
indicates thatthe road marking applies to the area.(4)However, a traffic control device does
not apply to an area ifinformation on or with the device
expressly indicates that thedevice does not
apply to the area.(5)Aparkingcontrolsignthatappliestoanareaappliestoparking bays on each length of road in the
area, and to otherparts of each length of road, as if it were
a parking controlsign applying only to that length of
road.Page 312Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 336](6)In this section—road, in
subsection (2)(a) and (c) and for an area of road, doesnot
include a road-related area.thedevice,insubsection(1)(b),includesanothertrafficcontrol
device.theroadmarking,insubsection(3)(b),includesanothertraffic control device.336How
separated footpath signs and separated footpathroad markings
apply(1)Aseparatedfootpathsign,orseparatedfootpathroadmarking,onafootpathappliesinthewaysetoutinthissection.(2)The
part of the footpath to the left of the centre of the
footpathis designated—(a)if a
pedestrian symbol is on the left side of the sign orthe
path—for the use of pedestrians; or(b)if a
bicycle symbol is on the left side of the sign or thepath—for the use of bicycles.(3)Thepartofthefootpathtotherightofthecentreofthefootpath is
designated—(a)if a pedestrian symbol is on the right
side of the sign orthe path—for the use of pedestrians;
or(b)if a bicycle symbol is on the right
side of the sign or thepath—for the use of bicycles.Division 3Application of
traffic controldevices to persons337Purpose of divisionThis division
explains when a traffic control device applies toa
person.Reprint 2C effective 30 November 2012Page
313
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 338]338References to traffic control
devices—application topersonsInapplyingthisregulationtoaperson,unlessthecontraryintention
appears, a reference to a traffic control device is areference to a traffic control device
applying to the person.339When do traffic
control devices apply to a person—thebasic
rules(1)A traffic control device applies to a
person if—(a)the device applies to the person under
a provision of thisdivision; or(b)the
device, the position of the device, or information onor
with the device indicates that the device applies to theperson.(2)Atrafficcontroldevicedoesnotapplytoapersonifinformation on or with the device expressly
indicates that itdoes not apply to the person.(3)Subsection(2)appliesdespiteanyotherprovisionofthisdivision.(4)In subsection (1)(b)—the
deviceincludes another traffic control
device.340Traffic control devices (except road
markings andparking control signs)(1)Atrafficcontroldevice(exceptaroadmarkingorparkingcontrol sign)
applies to a person if—(a)the device faces
the person; or(b)the person has passed the device and
the device facedthe person as the person approached
it.(2)However,thedevicedoesnotapplytothepersoniftheposition of the device indicates that
it does not apply to theperson.Page 314Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 20 Traffic
control devices and traffic-related items[s 341]Examples—1If a driver is driving in a marked
lane of a multi-lane road, a trafficlane arrow above
another marked lane does not apply to the driver.2If a driver is turning left using a
slip lane at an intersection, a trafficlight on the
right side of the painted island or traffic island thatseparates the slip lane from other parts of
the road does not apply tothe driver.3If a
driver is driving on a two-way road, a speed limit sign
facingonly traffic travelling in the opposite
direction does not apply to thedriver.341Road markingsA road marking
on the surface of a road applies to a person onthe road unless
the position of the road marking indicates thatit does not
apply to the person.Examples—1If a driver is driving on a road that
is not a multi-lane road orone-way road, a road marking to the
right of the centre of the roaddoes not apply to
the driver.2If a driver is driving in a marked
lane of a multi-lane road, a roadmarking in
another marked lane does not apply to the driver.3At an intersection, or on a
roundabout, road markings indicating theedge of a marked
lane for use by traffic coming from a particulardirection do not apply to a driver coming
from another direction.342Traffic signs
(except parking control signs) applying to alength of
road(1)Atrafficsign(exceptaparkingcontrolsign)applyingtoalength of road
and to drivers applies to a driver driving on thelength of road if the driver is driving in
the same direction as adriver on the road who faces the sign
before passing it.(2)A traffic sign applying to a length of
road and to pedestriansapplies to a pedestrian travelling on
the length of road if thepedestrian is travelling in the same
direction as a pedestrianon the road who faces the sign before
passing it.Reprint 2C effective 30 November 2012Page
315
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 20 Traffic control devices and
traffic-related items[s 343](3)The
traffic sign applies to the driver or pedestrian even thoughthe
driver or pedestrian does not pass the sign.Example—If a driver turns from a side road or
private land onto a length of road towhich a traffic
sign applies, the traffic sign applies to the driver eventhough the driver does not pass the
sign.(4)Subsections(1)to(3)donotaffecttheoperationoftheCriminal Code, section 24.Editor’s note—Criminal Code,
section 24 (Mistake of fact)343Traffic signs (except parking control signs)
applying to anarea(1)A
traffic sign (except a parking control sign) applying to anarea
and to drivers applies to a driver driving on any road inthe
area.(2)A traffic sign applying to an area and
to pedestrians applies toa pedestrian on any road in the
area.(3)The traffic sign applies to the driver
or pedestrian even thoughthe driver or pedestrian does not pass
the sign.Example—The
shared zone signs on the roads into a shared zone apply to a
driverwho starts a journey inside the shared
zone.(4)Subsections(1)to(3)donotaffecttheoperationoftheCriminal Code, section 24.344Traffic control devices applying to a
driver in a markedlaneA traffic
control device applying to a marked lane applies to adriver approaching, in or leaving the marked
lane unless theposition of the device indicates that it
does not apply to thedriver.Page 316Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 21
General[s 345]Example—An overhead lane control device above
a marked lane that the driverdoes not face as
the driver approaches it does not apply to the driver.345Traffic control devices applying to a
driver in a slip laneAtrafficcontroldeviceapplyingtoasliplaneappliestoadriver approaching, in or leaving the
slip lane.346Parking control signs(1)A parking control sign applying to a
length of road applies toa driver on the length of road.(2)A parking control sign applying to an
area applies to a driverin the area.(3)Aparkingcontrolsignappliestoadrivermentionedinsubsection (1) or (2) even though the driver
does not pass thesign.(4)Subsections(1)to(3)donotaffecttheoperationoftheCriminal Code, section 24.Part
21General347Meaning of abbreviations and symbolsSchedule 1 provides the meaning of certain
abbreviations andsymbols used in this regulation and on
traffic control devicesand traffic-related items.348References to a driver doing something
etc.If the context permits, a reference in this
regulation to a driverdoingornotdoingsomethingisareferencetothedrivercausing the driver’s vehicle to do or not to
do the thing.Reprint 2C effective 30 November 2012Page
317
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 21 General[s 349]Example—The
reference in section 27 to a driver turning left at an intersection
is areference to the driver causing the driver’s
vehicle to turn left at theintersection.349References to certain kinds of roadsA
reference in this regulation to a road of a particular kind is
areference to a road of that kind at any
relevant place.Example—Section 31 deals with a driver starting a
right turn at an intersection froma road (except a
multi-lane road). The section applies to a particulardriveronlyiftheroadfromwhichthedriveristurningisnotamulti-lane road
at the intersection. In applying the section to the driver,it is
irrelevant that the road is, or is not, a multi-lane road at
anotherplace away from the intersection.350References to stopping or parking on a
length of roadetc.(1)A
driver stops or parks on a length of road or in an area if
thedriver stops or parks the driver’s vehicle
so any part of thevehicle is on the length of road or in the
area.(2)Adriverstopsorparkswithinaparticulardistancefrom,before,orafter,somethingifthedriverstopsorparksthedriver’svehiclesoanypartofthevehicleiswithinthatdistance.Example for
subsection (2)—Section 190 provides that a driver
must not stop on a road within 10mbefore or after a
safety zone. The example diagram in section 190 showsa
vehicle stopped so part of the vehicle is within 10m of the zone.
Forsection 190, the vehicle is taken to be
stopped within 10m of the zone.(3)A
driver stops or parks on or across a driveway or other wayof
access for vehicles if the driver stops or parks the vehicle
sothat any part of the vehicle is on or across
the driveway or wayof access.(4)In
this section—Page 318Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 21
General[s 351]parkhas
the same meaning as in part 12.stophas
the same meaning as in part 12.351References to left and rightA
driver drives to the left, or right, of a line, sign or
anythingelse only if the driver’s vehicle is
completely to the left, orright, of the line, sign or other
thing.352References to stopping as near as
practicable to a placeA requirement in this regulation for a
driver to stop as near aspracticable to a place is not complied
with only because thedriver stops behind a vehicle that has
stopped at the place.Example—If a
driver stops behind a vehicle that has stopped at a stop sign or
stopline in accordance with section 67, 68 or
121, the driver must, after thevehicle has
proceeded, stop at the stop sign or stop line in accordancewith
the section.353Prescribed offences for ch 5, pt 7 of
the ActFor chapter 5, part 7 of the Act, offences
against the followingprovisions are prescribed
offences—(a)section 20;(b)section 56(1) and (2);(c)section 104(1), (2) and (3);(d)theTransportOperations(RoadUseManagement—VehicleRegistration)Regulation2010,sections 11 and 127(2)(f);(e)theMotorAccidentInsuranceAct1994,section20(1)and
(2).Reprint 2C effective 30 November 2012Page
319
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Part 22 Repeal and transitional
provisions[s 353A]353APeople with disabilities symbols—Act, sch
4,definitionpeople with
disabilities symbolFortheAct,schedule4,definitionpeoplewithdisabilitiessymbol,
the following symbols are prescribed—Part 22Repeal and transitionalprovisions354RepealTheTransportOperations(RoadUseManagement—RoadRules)
Regulation 1999, SL No. 246 is repealed.355Continuation of Transport Operations (Road
UseManagement—Road Rules) Regulation 1999, s
266DespitetherepealoftheTransportOperations(RoadUseManagement—RoadRules)Regulation1999,
section 266 ofthat regulation continues in force until the
end of 10 March2010.356References to Transport Operations (Road
UseManagement—Road Rules) Regulation
1999AreferenceinanActorotherdocumenttotheTransportOperations (Road Use Management—Road Rules)
RegulationPage 320Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Part 22 Repeal
and transitional provisions[s 356]1999is, if the
context permits, taken to be a reference to thisregulation.Reprint 2C
effective 30 November 2012Page 321
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 1Schedule 1Abbreviations and symbolssection 347Abbreviation/SymbolMONTUEWEDTHUFRISATSUNJANFEBMARAPRJUNJULAUGSEPOCTNOVDECAM or A.M.PM or
P.M.HOLSMAXMINSPUBVEHPage 322MeaningMondayTuesdayWednesdayThursdayFridaySaturdaySundayJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberthe time after
midnight and ending atmiddaythe time after
midday and ending atmidnightholidaysmaximumminutespublicvehicleReprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2Schedule 2Standard or
commonly usedtraffic signssections 314 and
316Area speed limit sign(section
22)Bicycle lane sign(sections 153,
252)Bicycle parking sign(section
201)Bicycle path sign(sections 239,
242, 252)Bridge load limit (gross mass) sign(section 103)Bridge load
limit (mass per axle group)sign(section 103)Reprint 2C
effective 30 November 2012Page 323
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2Buses must enter
sign(section 107)Bus lane
sign(section 154)Bus zone
sign(section 183)Children
crossing flag(section 80)Children’s
crossing sign(section 80)Clearance
sign(section 102)Page 324Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2Clearway sign(section
176)Emergency stopping lane only sign(section 95)End area speed
limit sign(section 22)End bicycle lane
sign(section 153)End bicycle path
sign(section 239)End bus lane
sign(section 154)Reprint 2C
effective 30 November 2012Page 325
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2End clearway
sign(section 176)End freeway
sign(sections 97, 177)End keep left
unless overtaking sign(section 130)End no bicycles
sign(section 252)End no
overtaking or passing sign(section 93)End no parking
area sign(section 335)Page 326Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2End
no stopping area sign(section 335)End parking area
sign(section 335)End road access
sign(section 97)End school zone
sign(section 23)End separated
footpath sign(section 239)End shared path
sign(section 242)Reprint 2C
effective 30 November 2012Page 327
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2End shared zone
sign(section 24)End speed limit
sign(section 21)End tram lane
sign(section 155)End transit lane
sign (End transit lane(T2) sign)(section
156)End transit lane sign (End transit
lane(T3) sign)(section
156)End trucks and buses low gear sign(section 108)Page 328Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2End
truck lane sign(section 157)End trucks use
left lane sign(section 159)Freeway
sign(section 177)Freeway
sign(section 177)Give way
sign(sections 69, 70, 71, 122)Gross load limit sign(section
103)Hand-held stop sign(section
80)Hand-held stop sign(section
80)Reprint 2C effective 30 November 2012Page
329
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2Hook turn only
sign(section 34)Keep left
sign(section 99)Keep left unless
overtaking sign(section 130)Keep right
sign(sections 99, 135)Left lane must
turn left sign(section 88)Left turn only
sign(section 88)Page 330Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2Left
turn on red after stopping sign(section
59)Level crossing sign(section
120)Level crossing sign(section
120)Level crossing sign(section
120)Loading zone sign(section
179)Low clearance sign(section
102)Reprint 2C effective 30 November 2012Page
331
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2Mail zone
sign(section 186)Median turning
lane sign(section 86)Motorbike
parking sign(section 202)No bicycles
sign(sections 239, 242, 252)No buses
sign(section 106)No entry
sign(section 100)No hook turn by
bicycles sign(section 36)No left turn
sign (Standard sign)(section 91)Page 332Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2No
left turn sign (Variable illuminatedmessage
sign)(section 91)No overtaking on
bridge sign(section 94)No overtaking or
passing sign(section 93)No parking sign
(for a length of road)(section 168)No parking sign
(for an area)(section 168)No pedestrians
sign(section 228)Reprint 2C
effective 30 November 2012Page 333
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2No right turn
sign (Standard sign)(section 91)No right turn
sign (Variable illuminatedmessage sign)(section
91)No stopping sign (for a length of
road)(section 167)No stopping sign
(for an area)(section 167)No trucks
sign(section 104)No turns
sign(section 90)Page 334Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2No
U-turn sign (Standard sign)(section
39)No U-turn sign (Variable illuminatedmessage sign)(section
39)One-way sign(section
98)One-way sign(section
98)Park in bays only sign(section
211)Pedestrian crossing sign(section
81)Pedestrians may cross diagonally signPeople with disabilities parking sign(sections 230, 234)(section
203)Reprint 2C effective 30 November 2012Page
335
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2Permissive
parking sign (for a length ofPermissive
parking sign (for a length ofroad)road)(section
204)(section 204)Permissive
parking sign (for an area)(section 204)Permissive
parking sign displaying apeople with disabilities symbol (for
alength of road)(section
203)Permissive parking sign displaying apeople with disabilities symbol (for
anarea)(section
203)Permit zone sign(section
185)Page 336Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2Right lane must turn right sign(section 89)Right turn only
sign(section 89)Road access
sign(sections 97, 229)Roundabout
sign(section 109)Safety zone
sign(sections 162, 190)Separated
footpath sign(sections 239, 252)Reprint 2C
effective 30 November 2012Page 337
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2School zone
sign(section 23)Shared path
sign(sections 242, 252)Shared zone
sign(section 24)Slow vehicle
turn out lane sign(section 130)Speed
derestriction sign(section 21)Speed limit sign
(Standard sign)(sections 21, 316)Page 338Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2Speed
limit sign (Variable illuminatedmessage
sign)(sections 21, 316)Stop here on red
arrow sign(section 56)Stop here on red
signal sign(section 56)Stop sign(sections 67, 68, 121)Taxi zone
sign(section 182)Traffic
light-stop sign(section 63)Reprint 2C
effective 30 November 2012Page 339
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 2Tram lane
sign(section 155)Transit lane
sign (Transit lane (T2) sign)(section
156)Transit lane sign (Transit lane (T3)
sign)(section 156)Truck lane
sign(section 157)Trucks and buses
low gear sign(section 108)Trucks must
enter sign(section 105)Page 340Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 2Trucks use left lane sign(section 159)Truck zone
sign(section 180)Two-way
sign(sections 98, 132, 136)U-turn permitted
sign(section 40)Works zone
sign(section 181)Reprint 2C
effective 30 November 2012Page 341
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3Schedule 3Other
permitted traffic signssections 314 and 316Area
speed limit sign(section 22)Area speed limit
sign(section 22)Area speed limit
sign(section 22)Bicycle lane
sign(sections 153, 252)Bicycle lane
sign(sections 153, 252)Bicycle path
sign(sections 239, 242, 252)Page 342Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3Bicycle path sign(sections 239,
242, 252)Bridge load limit (mass per axle
groupsign)(section
103)Bridge load limit (mass per axle groupsign)(section
103)Buses must enter sign(section
107)Bus lane sign(section
154)Bus lane sign(section
154)Reprint 2C effective 30 November 2012Page
343
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3Bus lane
sign(section 154)Bus lane
sign(section 154)Bus lane
sign(section 154)Bus lane
sign(section 154)Bus lane
sign(section 154)Bus lane
sign(section 154)Page 344Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3Bus
lane sign(section 154)Bus zone
sign(section 183)Bus zone
sign(section 183)Children’s
crossing sign(section 80)End area speed
limit sign(section 22)End area speed
limit sign(section 22)Reprint 2C
effective 30 November 2012Page 345
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3End area speed
limit sign(section 22)End bicycle lane
sign(section 153)End bicycle path
sign(section 239)End bicycle path
sign(section 239)End bus lane
sign(section 154)End bus lane
sign(section 154)Page 346Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3End
bus lane sign(section 154)End bus lane
sign(section 154)End freeway
sign(sections 97, 177)End freeway
sign(sections 97, 177)End freeway
sign(sections 97, 177)End freeway
sign(sections 97, 177)End keep left
unless overtaking sign(section 130)End school zone
sign(section 23)Reprint 2C
effective 30 November 2012Page 347
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3End school zone
sign(section 23)End school zone
sign(section 23)End school zone
sign(section 23)End separated
footpath sign(section 239)End shared path
sign(section 242)End shared zone
sign(section 24)Page 348Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3End
shared zone sign(section 24)End speed limit
sign(section 21)End tram lane
sign(section 155)End tramway
sign(section 155A)End transit lane
sign(section 156)End trucks and
buses low gear sign(section 108)Reprint 2C
effective 30 November 2012Page 349
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3End truck lane
sign(section 157)Freeway
sign(section 177)Freeway
sign(section 177)Freeway
sign(section 177)Freeway
sign(section 177)Freeway
sign(section 177)Hand-held stop
sign(section 80)Hand-held stop
sign(section 80)Page 350Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3Hand-held stop sign(section
80)Hand-held stop sign(section 80,
101)Keep right sign(sections 99,
135)Lane control ends sign(section
152)Left lane must turn left sign(section 88)Left turn only
sign(section 88)Reprint 2C
effective 30 November 2012Page 351
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3Loading zone
sign(section 179)Loading zone
sign(section 179)Median turning
lane sign(section 86)No bicycles
sign(sections 239, 242, 252)No entry
sign(section 100)No entry
sign(section 100)Page 352Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3No
entry sign(section 100)No entry
sign(section 100)No left turn
sign (Standard sign)(section 91)No left turn
sign (Variable illuminatedmessage sign)(section
91)No overtaking on bridge sign(section 94)No parking sign
(for a length of road)(section 168)Reprint 2C
effective 30 November 2012Page 353
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3No parking sign
(for a length of road)No parking sign (for a length of
road)(section 168)(section
168)No parking sign (for a length of road)(section 168)No parking sign
(for an area)(section 168)No parking sign
(for an area)(section 168)No parking sign
(for an area)(section 168)Page 354Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3No
recreational devices or toys sign(section
240A)No right turn sign (Standard sign)(section 91)No right turn
sign (Variable illuminatedmessage sign)(section
91)No right turn sign(section
91)No stopping sign (for a length of
road)No stopping sign (for a length of
road)(section 167)(section
167)Reprint 2C effective 30 November 2012Page
355
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3No stopping sign
(for a length of road)(section 167)No stopping sign
(for an area)(section 167)No stopping
sign(section 167)No U-turn sign
(Standard sign)(section 39)No U-turn sign
(Variable illuminatedNo wheeled recreational devices or
toysmessage sign)sign(section 39)(section
240A)Page 356Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3One-way sign(section
98)Pedestrians may cross diagonally sign(sections 230, 234)Permissive
parking sign (for a length ofPermissive
parking sign (for a length ofroad)road)(section
204)(section 204)Permissive
parking sign (for a length ofPermissive
parking sign (for a length ofroad)road)(section
204)(section 204)Reprint 2C
effective 30 November 2012Page 357
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3Permissive
parking sign (for an area)Permissive parking sign (for an
area)(section 204)(section
204)Permissive parking sign (for an area)Permissive parking sign (for an area)(section 204)(section
204)Permit zone sign(section
185)Permit zone sign(section
185)Page 358Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3Right lane must turn right sign(section 89)Right turn only
sign(section 89)Right turn only
sign(section 89)Road access
sign(sections 97, 229)School zone
sign(section 23)School zone
sign(section 23)Reprint 2C
effective 30 November 2012Page 359
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3School zone
sign(section 23)School zone
sign(section 23)School zone
sign(section 23)School zone
sign(section 23)School zone
sign(section 23)School zone
sign(section 23)Page 360Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3School zone sign(section
23)School zone sign(section
23)Separated footpath sign(sections 239,
252)Shared path sign(sections 242,
252)Shared zone sign(section
24)Shared zone sign(section
24)Reprint 2C effective 30 November 2012Page
361
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3Stop here on red
signal sign(section 56)Taxi zone
sign(section 182)Taxi zone
sign(section 182)Taxi zone
sign(section 182)Taxi zone
sign(section 182)Tram lane
sign(section 155)Page 362Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 3Tram
lane sign(section 155)Tramway
sign(section 155A)Transit lane
sign(section 156)Transit lane
sign(section 156)Truck arrester
bed(section 101A)TRUCKARRESTERBEDTrucks and buses low gear sign(section 108)Truck arrester
bed(section 101A)TRUCKARRESTERBEDTrucks and buses low gear sign(section 108)Reprint 2C
effective 30 November 2012Page 363
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 3Trucks must
enter sign(section 105)Trucks must
enter sign(section 105)Trucks use left
lane sign(section 159)Truck zone
sign(section 180)Two-way
sign(sections 98, 132, 136)Works zone
sign(section 181)Page 364Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 4Schedule 4Symbols and
traffic-relateditemssections 314, 316
and 320Do not overtake turning vehicle sign(sections 28, 32, 143)Do not overtake
turning vehicle sign(sections 28, 32, 143)Fire
hydrant indicator (example)(section
194)Fire hydrant indicator (example)(section 194)Fire plug
indicator (example)(section 194)Give way to
buses sign(section 77)Reprint 2C
effective 30 November 2012Page 365
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 4Green bicycle
symbol(section 260)Green pedestrian
symbol(section 231)People with
disabilities symbol(section 203)People with
disabilities symbol(section 203)Red bicycle
symbol(section 260)Red pedestrian
symbol(section 231)White B
light(section 285)White T
light(section 278)Page 366Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 4Yellow bicycle symbol(section
261)Reprint 2C effective 30 November 2012Page
367
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5Schedule 5Dictionarysection 4approved bicycle helmetmeans a helmet
that complies with—(a)AS 2063.1 and 2063.2; or(b)another standard the chief executive
considers is at leastequal to that standard.areaincludes—(a)a bridge; and(b)a
network of roads; and(c)a slip
lane.bicycle crossing lightmeans a green,
yellow or red bicyclecrossing light.bicyclecrossinglightsmeansadevicedesignedtoshowabicycle crossing light, or 2 or more bicycle
crossing lights atdifferent times.bicycle
lanesee section 153.bicycle
pathsee section 239.bicycle path
road markingsee section 239.bicycle storage
areameans—(a)anareaofaroadbeforeanintersectionwithtrafficlights—(i)that has painted on it 1 or more
bicycle symbols;and(ii)that is between
2 parallel stop lines, regardless ofwhether the
lines are of equal length; and(iii)that
opens out from a bicycle lane; but(b)does
not include any stop line.Page 368Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5bicycle symbolmeans a symbol
consisting of a picture of abicycle.B
lightmeans a red, white or yellow B light.B
lightsmeans a device designed to show a B light,
or 2 ormore B lights at different times.built-up area, in relation to
a length of road, means an area inwhich either of
the following is present for a distance of atleast 500m or,
if the length of road is shorter than 500m, forthe whole
road—(a)buildings, not over 100m apart, on
land next to the road;(b)street lights
not over 100m apart.busmeans a motor
vehicle built mainly to carry people thatseats over 12
adults (including the driver).bus lanesee
section 154.bus zonesee section
183.centre of the road, for a driver
on a two-way road, means thefar right side
of the part of the road used by traffic travellingin
the same direction as the driver.changes
directionsee section 45.children’s
crossingsee section 80.continuing
road, for a T-intersection, means the road
(exceptaroad-relatedarea)thatmeetstheterminatingroadattheT-intersection.crashincludes—(a)a
collision between 2 or more vehicles; or(b)another accident or incident involving a
vehicle in whicha person is killed or injured, property is
damaged, or ananimal in someone’s charge is killed or
injured.crossingmeans—(a)a children’s crossing; or(b)a level crossing; orReprint 2C effective 30 November 2012Page
369
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5(c)a
marked foot crossing; or(d)a pedestrian
crossing.dividinglinemeansaroadmarkingformedbyaline,or2parallellines,whetherbrokenorcontinuous,designedtoindicate the parts of the road to be
used by vehicles travellingin opposite
directions.dividing stripmeans an area or
structure that divides a roadlengthways, but
does not include a nature strip, bicycle path,footpath or
shared path.do not overtake turning vehicle signmeans a sign with—(a)a
minimum area of 0.125m2; and(b)thewords‘donotovertaketurningvehicle’inblocklettersatleast50mmhighinblackletteringonaretroreflective
yellow background.driveincludes be in
control of.driversee sections 16
and 19.driver’s vehiclefor a driver,
means the vehicle being drivenby the
driver.edge line, for a road,
means a line marked along the road at ornearthefarleftorfarrightsideoftheroad(exceptanyroad-related area of the road).emergency stopping lanesee section
95.emergency vehiclemeans a motor
vehicle driven by a personwho is—(a)an
emergency worker; and(b)driving the
vehicle in the course of performing duties asan emergency
worker.emergency workermeans—(a)an officer of the Queensland Ambulance
Service or anambulance service of another State;
or(b)a fire officer under theFire
and Rescue Service Act 1990or a fire and
rescue service of another State; orPage 370Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5(c)an officer or employee of another
entity with the writtenpermission of the commissioner.end
bicycle path road markingsee section 239.end separated
footpath road markingsee section 239.enter, an
intersection or crossing, for the driver of a vehicle ora
train, means enter the intersection or crossing with any
partof the vehicle or train.freewaysee
section 177.front fog lightsee section
217.give way, for a driver
or pedestrian, means—(a)if the driver or
pedestrian is stopped—remain stationaryuntil it is safe
to proceed; or(b)in any other case—slow down and, if
necessary, stop toavoid a collision.give way
linemeans a broken line that is marked across
all orpart of a road and is not part of a marked
foot crossing.greenbicyclecrossinglightmeansanilluminatedgreenbicycle symbol as shown in the diagram in
schedule 4.green pedestrian lightmeans—(a)an illuminated green pedestrian
symbol; or(b)theword‘walk’illuminatedingreen(whetherornotflashing).greenpedestriansymbolmeansasymbolconsistingofapicture of a pedestrian as shown in
the diagram in green inschedule 4.green traffic
arrowmeans an illuminated green arrow.green traffic lightmeans an
illuminated green disc.halfway around, for a
roundabout, see section 110.hazardwarninglightsmeansapairofyellowdirectionindicatorlightsfittedtoavehicleundertheStandardsandSafety Regulation that display regular
flashes of light at thesame time, and at the same rate, as
each other.Reprint 2C effective 30 November 2012Page
371
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5heavy
vehiclemeans a vehicle with a GVM of 4.5t or
more.high-beam, for a
headlight fitted to a vehicle, means that theheadlight is
built or adjusted so, when the vehicle is standingon
level ground, the top of the main beam of light projected isabove the headlight’s low-beam.hook
turnsee sections 34 and 35.intersectionmeanstheareawhere2ormoreroads(exceptany
road-related area) meet, and includes—(a)anyareaoftheroadswherevehiclestravellingondifferent roads might collide; and(b)theplace,otherthanaroad-relatedarea,whereasliplane between the
roads meets the road into which trafficon the slip lane
may turn.landincludes
premises or a part of premises.left change of
direction signalmeans a change of directionsignal given in accordance with section
47.left traffic lane arrowsmeans traffic
lane arrows applying toa marked lane that indicate only a
direction to the left.lengthof road
includes—(a)a marked lane or a part of a marked
lane; and(b)another part of a length of
road.level crossingsee section
120.line of trafficmeans—(a)2 or more vehicles, other than
vehicles in a marked lane,travelling in line on a road, whether
or not the vehiclesare moving; or(b)a
single vehicle, other than a vehicle in a marked lane ora
vehicle that is part of a line of traffic under paragraph(a),thatistravellingalongaroad,whetherornotthevehicle is moving.Page 372Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5Examples—1A vehicle travelling on a road, other
than in a marked lane, in linebehind another
vehicle forms part of a line of traffic with the othervehicle.2A
vehicle travelling on a road, other than in a marked lane, with
noother vehicles near it forms a line of
traffic by itself.3Two vehicles travelling in the same
direction on a road, other thanin a marked lane,
but not in line, form 2 lines of traffic.low-beam,
for a headlight fitted to a vehicle, means that theheadlight is built or adjusted so, when the
vehicle is standingon level ground, the top of the main beam of
light projectedis—(a)nothigherthanthecentreoftheheadlight,whenmeasured 8m in front of the vehicle;
and(b)not over 1m higher than the level
where the vehicle isstanding, when measured 25m in front
of the vehicle.mail zonesee section
186.marked foot crossingmeans an area of
a road—(a)ataplacewithpedestrianlightsfacingpedestrianscrossingtheroadandtrafficlightsfacingvehiclesdriving on the road; and(b)indicatedbyadifferentroadsurface,orbetween2parallel continuous or broken lines, or rows
of studs ormarkers, on the road surface substantially
from 1 side ofthe road to the other.Example of a
different road surface—The area of road
could be indicated by brick paving across abitumen
road.marked lanemeans an area of
a road marked by continuous orbroken lines, or
rows of studs or markers, on the road surfacethat is designed
for use by a single line of vehicles.mechanical
signalling devicemeans a mechanical signallingdevice under the Standards and Safety
Regulation.median stripmeans a dividing
strip designed or developed toseparate
vehicles travelling in opposite directions.Reprint 2C
effective 30 November 2012Page 373
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5median strip
parking areameans a parking area on, or in, amedian strip.multi-laneroad,foradriver,meansaone-wayroad,oratwo-way road,
with 2 or more marked lanes (except bicyclelanes) that
are—(a)on the side of the dividing line or
median strip where thedriver is driving; and(b)for the use of vehicles travelling in
the same direction.nature strip, except in
section 13(1), means an area between aroad (except a
road-related area) and adjacent land, but doesnot include a
bicycle path, footpath or shared path.nightmeans the period between sunset on a day and
sunriseon the next day.no bicycles road
markingmeans a road marking consisting ofa
bicycle symbol with a diagonal line across it, or the words‘no
bicycles’, or both the symbol and the words.obstructionincludes a
traffic hazard, but does not include avehicleonlybecausethevehicleisstoppedintrafficoristravelling more slowly than other
vehicles.oncoming vehicle, for a driver,
means a vehicle approachingthe driver
travelling in the opposite direction to the directionin
which the driver is driving.one-way
roadmeans a road with 1 or more marked lanes,
allofwhicharefortheuseofvehiclestravellinginthesamedirection.overhead lane
control devicemeans an overhead lane controlsign
or signal.overhead lane control signmeans a traffic sign displaying ared
diagonal cross that is installed on a structure over a road
orpart of a road.overhead lane
control signalmeans—(a)anilluminatedreddiagonalcross(whetherornotflashing); orPage 374Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5(b)anilluminatedwhite,greenoryellowarrowpointingdownwards or
indicating 1 or more directions; or(c)a
speed limit sign (variable illuminated message sign).overhead lane control signalsmeans a device on a structureover
a road, or part of a road, that is designed to display anoverheadlanecontrolsignal,or2ormoreoverheadlanecontrol
signals.oversize warning signmeans a sign
that—(a)displaystheword‘oversize’inblack,upper-caseandnon-reflective letters that—(i)are at least 200mm high and at least
125mm fromthe top and bottom of the sign; and(ii)are in typeface
series C(N); and(iii)complywithAS1744Formsoflettersandnumerals(knownasstandardalphabetsforroadsigns);
and(b)isatleast450mmhighandatleast1200mmlong,whether or not
it is split; and(c)for a split sign—does not have a
border between the 2parts of the sign; and(d)except for the part of its surface
required to be made ofretroreflectivematerial,ismadeofrigid,flatandweatherproof material unless, for a
sign attached to therear of a vehicle, the vehicle’s load
makes it impracticalto have a rigid warning sign;
and(e)is clean enough to be easily read by
other road users.overtake, for a driver,
means the action of—(a)approaching from
behind another driver travelling in thesame marked lane
or line of traffic; and(b)moving into an
adjacent marked lane or a part of a roadwhere there is
room for a line of traffic, whether or notthe lane or part
of the road is for drivers travelling in thesame direction;
andReprint 2C effective 30 November 2012Page
375
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5(c)passing the other driver while travelling in
the adjacentmarked lane or line of traffic.painted islandmeans an area of
a road that—(a)has painted on it stripes or chevrons
in white or anothercolour that contrasts with the colour of the
road; and(b)is surrounded either—(i)by a line or lines (whether broken or
continuous);or(ii)partly by a
combination of a line or lines (whetherbroken or
continuous) and partly by a kerb or by astructure on or
next to the road.parkingareameansalengthofroadorareadesignedforparking vehicles.parking control
signmeans any of the following—(a)a bicycle parking sign;(b)a bus zone sign;(c)a
clearway sign;(d)a loading zone sign;(e)a mail zone sign;(g)a
motorbike parking sign;(h)a no parking
sign;(i)a no stopping sign;(j)a people with disabilities parking
sign;(k)a permissive parking sign;(l)a permit zone sign;(m)a taxi zone sign;(n)a
truck zone sign;(o)a works zone sign.part of the road
used by the main body of moving vehiclesmeans the area
of the road, except—Page 376Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5(a)a road-related area; and(b)if the road has 1 or more service
roads—the area of aservice road.passengertransportstandardmeanstheTransportOperations
(Passenger Transport) Standard 2010.pedestrian crossingsee section
81.pedestrianlightsmeansadevicedesignedtoshow,atdifferent times, a green or red pedestrian
light.pedestrian symbolmeans a symbol
consisting of a picture of apedestrian.people with
disabilities road markingsee section 203.people with
disabilities symbolmeans a picture of a personseated in a wheelchair as shown in the
diagrams in schedule 4.permit zonesee section
185.police vehiclemeans a vehicle
driven by a police officer oftheQueenslandPoliceService,orthepoliceserviceoftheCommonwealth or
another State, in the course of the policeofficer’s
duty.portable warning trianglemeans a device that complies withAS
3790–1992.postal vehiclemeans a vehicle
driven by a person who is—(a)a postal worker;
and(b)driving the vehicle in the course of
performing duties asa postal worker.postalworkermeansanemployeeof,orcontractororsubcontractor with, the Australian Postal
Corporation.red bicycle crossing lightmeans an illuminated red bicyclesymbol (whether or not flashing) as shown in
the diagram inschedule 4.red B
lightmeans an illuminated red B.red
pedestrian lightmeans—Reprint 2C
effective 30 November 2012Page 377
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5(a)anilluminatedredpedestriansymbol(whetherornotflashing); or(b)thewords‘don’twalk’illuminatedinred(whetherornot
flashing).red pedestrian symbolmeans a symbol
consisting of a pictureof a pedestrian as shown in the
diagram in red in schedule 4.red T
lightmeans an illuminated red T.red
traffic arrowmeans an illuminated red arrow.red
traffic lightmeans an illuminated red disc.ride,fortheriderofamotorbikeoranimal-drawnvehicle,includes be in control of.ridersee section
17.right change of direction signalmeans a change of directionsignal given in accordance with section
49.right traffic lane arrowsmeans traffic lane arrows applying toa
marked lane that indicate only a direction to the right.roadsee section
11.Note—See also the
definitionroadin schedule 4 of the Act.roadmarkingmeansaword,figure,symbol,mark,line,raised marker or
stud, or something else, on the surface of aroad to direct
or warn traffic, but does not include a paintedisland.road-related areasee section
13.road usersee section
14.roundaboutsee section
109.safety zonesee section
162.school bussee the
passenger transport standard, schedule 4.school
zonesee section 23.separated
footpathsee section 239.separated
footpath road markingsee section 239.Page 378Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5service roadmeans the part
of a road that—(a)is separated from other parts of the
road by a dividingstripthatisnotdesignedordeveloped,whollyormainly,toseparatevehiclestravellinginoppositedirections;
and(b)is—(i)designedordevelopedtobeused,whollyormainly, by traffic servicing adjacent
land; or(ii)indicated to be
a service road by information on orwith a traffic
control device on the road.shared
pathsee section 242.shared
zonesee section 24.shouldersee
section 13.slip lanemeans an area of
road for vehicles turning left that isseparated,atsomepoint,fromotherpartsoftheroadbyapainted island or traffic
island.special purpose lanemeans a marked
lane, or the part of amarkedlane,thatisabicyclelane,buslane,emergencystopping lane, tram lane, transit lane or
truck lane.speed limited areasee section
22.StandardsandSafetyRegulationmeanstheTransportOperations (Road
Use Management—Vehicle Standards andSafety)
Regulation 1999.Editor’s note—Transport Operations (Road Use
Management—Vehicle Standards andSafety)Regulation1999—seetheTransportOperations(RoadUseManagement—Vehicle Standards and
Safety) Regulation 2010, section47.stop, in part 12 and
for a driver, includes park, but does notinclude stop to
reverse the driver’s vehicle into a parking bayor other parking
space.stop linemeans a
continuous line that—(a)is marked across
all or part of a road; andReprint 2C effective 30 November
2012Page 379
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5Page 380(b)isnotpartofamarkedfootcrossing,akeepclearmarking or a bicycle storage area for hook
turns.straight aheadincludes
substantially straight ahead.taximeans—(a)for
section 182—a taxi under theTransport
Operations(Passenger Transport) Act 1994;
or(b)otherwise—a taxi or limousine under
that Act.taxi zonesee section
182.terminating road, for a
T-intersection, means—(a)if a road
(except a road-related area) at the intersectionisdesignatedbytrafficsignsorroadmarkings,orinanother way, as
a road that ends at the intersection—thatroad; or(b)in any other case—a road(except a road-related area)that
ends at the intersection.T-intersectionmeans an
intersection, other than a roundabout,where 2 roads
meet (whether or not at right angles) and 1 ofthe roads
ends.T lightmeans a red,
white or yellow T light.T lightsmeans a device
designed to show a T light, or 2 ormore T lights at
different times.trafficincludes
vehicles and pedestrians.traffic arrowmeans a green,
white or red traffic arrow, or ayellow traffic
arrow (whether or not flashing).trafficarrowsmeansadevicedesignedtoshowatrafficarrow, or 2 or
more traffic arrows at different times.trafficcontroldevicemeansatrafficsign,roadmarking,trafficsignals,orotherdevice,todirectorwarntrafficon,entering or leaving a road.traffic islandmeans a
structure on a road to direct traffic, butdoes not include
a road marking or painted island.trafficlanearrowsmeansatrafficsign,roadmarkingordevicethatdisplaysarrowsindicating1ormoredirectionsReprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5and
is designed to apply to 1 or more marked lanes, but doesnot
include traffic arrows.trafficlightmeansagreentrafficlight,oraredoryellowtraffic light
(whether or not flashing).traffic lightsmeans a device
designed to show a traffic light,or2ormoretrafficlightsinaverticalarrangementandatdifferent times, and includes any
traffic arrows installed withor near the
device.traffic lights polemeans a pole or
other structure on whichtraffic lights are installed.traffic-related itemmeans any of the
following—(a)a do not overtake turning vehicle
sign;(b)a give way to buses sign;(c)a fire hydrant indicator or fire plug
indicator.traffic signmeans a board,
plate, screen, or another device,whetherornotilluminated,displayingwords,figures,symbols or
anything else to direct or warn traffic on, enteringorleavingaroad,andincludesachildrencrossingflag,ahand-heldstopsign,aparkingcontrolsignandavariableilluminated
message sign, but does not include traffic signals.trafficsignalsmeansbicyclecrossinglights,Blights,overheadlanecontrolsignals,pedestrianlights,Tlights,traffic arrows,
traffic lights or twin red or yellow lights.tram lanesee
section 155.tramrecoveryvehiclemeansavehicleusedbyatramoperator to access and recover disabled
trams for which thetram operator is responsible.tram
stopmeans a place on a road at which there is a
signindicating that trams will stop to enable
people to get on oroff.tram
tracksincludes a rail designed for a light rail
vehicle torun on.tramwaysee
section 155A.transit lanesee section
156.Reprint 2C effective 30 November 2012Page
381
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Schedule 5Page 382travelling along tram tracks,
for a bus, means being drivenalong the area
where the tram tracks are laid.truck
lanesee section 157.truck
zonesee section 180.turning
lanemeans a marked lane, or the part of a
markedlane, for vehicles travelling in 1 direction
to which—(a)a left turn only sign, a left lane
must turn left sign or lefttraffic lane
arrows apply; or(b)a right turn only sign, a right lane
must turn right sign orright traffic lane arrows
apply.turn linemeans a road
marking, at an intersection, consistingof a line
(whether broken or continuous) that is designed toindicate how a turn is to be made at the
intersection.twinredlightsmeansadeviceshowing,inahorizontalordiagonalarrangement,2illuminatedreddiscsthatflashalternately.twin yellow
lightsmeans a device showing, in a horizontal
ordiagonalarrangement,2illuminatedyellowdiscsthatflashalternately.two-way
roadmeans a road for use by vehicles travelling
inopposite directions.U-turnmeansaturnmadebyadriversothatthedriver’svehiclefacesinapproximatelytheoppositedirectionfromwhich it was
facing immediately before the turn was made,but does not
include a turn made at a roundabout.variable
illuminated message devicemeans a device designedtodisplay,andtochangeorturnofffromtimetotimebyelectronicoropticalmeans,illuminatedwords,figures,symbols,oranythingelse,todirectorwarntrafficon,entering or leaving a road, but does
not include traffic signals.variableilluminatedmessagesignmeanstheilluminatedwords,figures,symbols,orotherthings,displayedatanyrelevant time on a variable
illuminated message device.vehiclesee
section 15.Reprint 2C effective 30 November
2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Schedule 5white B lightmeans an
illuminated white B as shown in thediagram in
schedule 4.white T lightmeans an
illuminated white T as shown in thediagram in
schedule 4.white traffic arrowmeans an
illuminated white arrow.window, in relation to
a vehicle, includes any sunroof fitted tothe
vehicle.with, for
information about the application of a traffic controldevice, includes accompanying or reasonably
associated withthe device.yellowbicyclecrossinglightmeansanilluminatedyellowbicyclesymbol(whetherornotflashing)asshowninthediagram in schedule 4.yellow B lightmeans an
illuminated yellow B.yellow T lightmeans an
illuminated yellow T.yellow traffic arrowmeans an illuminated yellow arrow.yellow traffic lightmeans an
illuminated yellow disc.Reprint 2C effective 30 November
2012Page 383
Transport Operations (Road Use Management—Road
Rules) Regulation 2009EndnotesEndnotes1Index to endnotesPage2Date to which amendments incorporated
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.3843Key . . . . . . . . . . . . . . . . .
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . . . . . .3854Table of reprints
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . . . . . . . . . . . . .3855List
of legislation . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . . . . . . . . . . . . . . . . . . . .3866List of annotations . . . . . . . . .
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
. . . . . .3872Date to which amendments
incorporatedThis is the reprint date mentioned in the
Reprints Act 1992, section 5(c). Accordingly, thisreprint includes all amendments that
commenced operation on or before 30 November2012. Future
amendments of the Transport Operations (Road Use
Management—RoadRules) Regulation 2009 may be made in
accordance with this reprint under the ReprintsAct 1992, section
49.Page 384Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009Endnotes3KeyKey to
abbreviations in list of legislation and annotationsKeyAIAamdamdtchdefdivexpgazhdginslapnotfdnumo in comorigpparaprecpresprevExplanation=Acts
Interpretation Act 1954=amended=amendment=chapter=definition=division=expires/expired=gazette=heading=inserted=lapsed=notified=numbered=order
in council=omitted=original=page=paragraph=preceding=present=previousKey(prev)procprovptpubdR[X]RArelocrenumrep(retro)rvsschsdivSIASIRSLsubunnumExplanation=previously=proclamation=provision=part=published=Reprint No. [X]=Reprints Act 1992=relocated=renumbered=repealed=retrospectively=revised edition=section=schedule=subdivision=Statutory Instruments Act 1992=Statutory Instruments Regulation
2002=subordinate legislation=substituted=unnumbered4Table of reprintsReprints are
issued for both future and past effective dates. For the most
up-to-date tableof reprints, see the reprint with the latest
effective date.Ifareprintnumberincludesaletterofthealphabet,thereprintwasreleasedinunauthorised, electronic form only.ReprintNo.11A1B1C1D1E1F22A2B2CAmendments
includednonenone2010 SL No.
652010 SL No. 1912010 SL No.
2952011 SL No. 32011 SL No.
32011 SL No. 8—2011
SL No. 2122011 SL No. 2872012 SL No.
215Effective12 October
200911 March 201016 April
20101 September 201022 October
201028 January 201131 March
201131 March 201128 October
20119 December 201130 November
2012Notescertain
provscommencedR1F withdrawn,
see R2Reprint 2C effective 30 November 2012Page
385
Transport Operations (Road Use Management—Road
Rules) Regulation 2009Endnotes5List
of legislationRegulatory impact statementsFor
subordinate legislation that has a regulatory impact statement,
specific reference to the statementis included in
this list.Explanatory notesAll subordinate
legislation made on or after 1 January 2011 has an explanatory
note. For subordinatelegislation made before 1 January 2011
that has an explanatory note, specific reference to the note
isincluded in this list.Transport
Operations (Road Use Management—Road Rules) Regulation 2009
SLNo. 194 (may also be cited as Queensland
Road Rules)made by the Governor in Council on 10
September 2009notfd gaz 11 September 2009 pp 148–9ss
1–2 commenced on date of notificationss 266, 267(1),
(1AA), (1AB), (1A), (1B), (1C) commenced 11 March 2010 (see
s2(2))remaining
provisions commenced 12 October 2009 (see s 2(1))exp 1
September 2020 (see SIA s 54)Note—The expiry
date may have changed since this reprint was published. See
thelatest reprint of the SIR for any
change.amending legislation—TransportOperations(RoadUseManagement—RoadRegulation (No.
1) 2010 SL No. 65notfd gaz 16 April 2010 pp 952–3commenced on date of notificationRules)AmendmentTransport Operations (Road Use
Management—Vehicle Registration) Regulation2010 SL No. 191
ss 1–2, 133 sch 7notfd gaz 23 July 2010 pp 1196–9ss
1–2 commenced on date of notificationremaining
provisions commenced 1 September 2010 (see s 2)Transport
Legislation Amendment Regulation (No. 3) 2010 SL No. 295 pts 1,
3notfd gaz 22 October 2010 pp 475–6commenced on date of notificationTransport and Other Legislation Amendment
Regulation (No. 1) 2011 SL No. 3 pts 1,3notfd
gaz 28 January 2011 pp 156–7s 6 commenced 31
March 2011 (see s 2)remaining provisions commenced on date of
notificationTransport Legislation Amendment Regulation
(No. 1) 2011 SL No. 8 pts 1, 5notfd gaz 25
February 2011 pp 327–8ss 1–2 commenced on date of
notificationremaining provisions commenced 31 March 2011
(see s 2)Page 386Reprint 2C
effective 30 November 2012
Transport Operations (Road Use
Management—Road Rules) Regulation 2009EndnotesTransport Legislation Amendment Regulation
(No. 4) 2011 SL No. 212 pts 1, 3notfd gaz 28
October 2011 pp 398–9commenced on date of
notificationTransport Legislation Amendment Regulation
(No. 6) 2011 SL No. 287 pts 1, 3notfd gaz 9
December 2011 pp 729–35commenced on date of
notificationTransport and Other Legislation Amendment
Regulation (No. 1) 2012 SL No. 215 pts1, 4notfd
gaz 30 November 2012 pp 444–6commenced on date
of notification6List of annotationsClearance and low clearance signss
102amd 2011 SL No. 3 s 6Complying with
overhead lane control devicess 152amd
2011 SL No. 3 s 7Time extension for people with
disabilitiess 206amd 2011 SL No. 8 s 20Using
hazard warning lightss 221amd 2010 SL No.
295 s 11Using horns and similar warning
devicess 224amd 2010 SL No. 295 s 12Riding
with a person on a bicycle trailers 257amd
2010 SL No. 65 s 3Wearing of seatbelts by passengers under 16
years olds 266amd 2010 SL No. 65 s 4Exemptions from wearing seatbeltss
267amd 2010 SL No. 65 s 5Driving on a
paths 288amd 2011 SL No. 212 s 8Driver
must not damage rail infrastructure or obstruct level
crossings 300Dins 2012 SL No.
215 s 7Prescribed offences for ch 5, pt 7 of the
Acts 353amd 2010 SL No. 191 s 133 sch 7Peoplewithdisabilitiessymbols—Act,sch4,definition“peoplewithdisabilitiessymbol”s
353Ains 2011 SL No. 8 s 21Reprint 2C
effective 30 November 2012Page 387